SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2806.m00032|PY07543|PY07543|MSP4/5|p_yoelii|chr_0|MALPY02806|2806 from Plasmodium yoelii ssp. yoelii 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2806.m00032|PY07543|PY07543|MSP4/5|p_yoelii|chr_0|MALPY02806|2806
Domain Number 1 Region: 148-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000161
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2806.m00032|PY07543|PY07543|MSP4/5|p_yoelii|chr_0|MALPY02806|2806
Sequence length 213
Sequence
MKITNYLSIINLFVVLLISFKNVHEISLINTKKYQRNIFCAKRILGDPPSANPSTSLNQN
EDNHNSNPDANKGNTNKSDKLNGDNIPNSQSKSENTNLSESPKTGTASNPPQPEPSVQPG
NTNGDSQNSIHSDDEEEDDEDEDDDEEDCSVNNGGCGENLLCEKMESGIIKCSCPSGYKL
NGTSCIELLSAHSVNYCFCGILIILIILVSMIY
Download sequence
Identical sequences Q7R7N9 Q9NJW2 V7PC04
XP_728466.1.76580 73239.Q7R7N9 2806.m00032|PY07543|PY07543|MSP4/5|p_yoelii|chr_0|MALPY02806|2806 gi|82794512|ref|XP_728466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]