SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dicsq1|101883|estExt_Genewise1Plus.C_6_t20091 from Dichomitus squalens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicsq1|101883|estExt_Genewise1Plus.C_6_t20091
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily Fungal immunomodulatory protein, FIP 2.09e-45
Family Fungal immunomodulatory protein, FIP 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicsq1|101883|estExt_Genewise1Plus.C_6_t20091
Sequence length 111
Sequence
MVDTSVLLALAAQHQRVHFDYTPAWGRGSPASYVDNVTFPHVLDDKAYQYRVIVGDKDLG
LRKSYSIQPDGSQKVNFLEYNGGYGIADSNRIRVYVVDPESGNQYLIAQWN
Download sequence
Identical sequences XP_007363541.1.3125 jgi|Dicsq1|101883|estExt_Genewise1Plus.C_6_t20091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]