SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dicsq1|125142|fgenesh1_pg.5_#_48 from Dichomitus squalens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicsq1|125142|fgenesh1_pg.5_#_48
Domain Number 1 Region: 7-114
Classification Level Classification E-value
Superfamily Fungal immunomodulatory protein, FIP 1.31e-48
Family Fungal immunomodulatory protein, FIP 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicsq1|125142|fgenesh1_pg.5_#_48
Sequence length 115
Sequence
MSAHVNSTAITFALVWAEKKLTFDYTPNWVRGHPSSYVDNVVFPKVLTDKKYSYRVLVSG
KDLGVRDGYSVQSDGSQKVNFLEYNAGRGIADSNTIQVYAVDPDDGNNYLVAQCN
Download sequence
Identical sequences jgi|Dicsq1|125142|fgenesh1_pg.5_#_48 XP_007362866.1.3125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]