SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dicsq1|53695|e_gw1.5.456.1 from Dichomitus squalens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicsq1|53695|e_gw1.5.456.1
Domain Number 1 Region: 7-111
Classification Level Classification E-value
Superfamily Fungal immunomodulatory protein, FIP 5.36e-32
Family Fungal immunomodulatory protein, FIP 0.0000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicsq1|53695|e_gw1.5.456.1
Sequence length 123
Sequence
MFAPLTTATIFALVWTQTKICFDYTPDWIDGGPRYINGVVFPKVLTDKNYSYRVESDRDY
GVRAGYQVQADGSQKVNFLDYNYGLGIEPYRGIKVYVVDPDDGKNYLVAELEMDQRERCA
GGD
Download sequence
Identical sequences XP_007362863.1.3125 jgi|Dicsq1|53695|e_gw1.5.456.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]