SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dicsq1|173458|gm1.9227_g from Dichomitus squalens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicsq1|173458|gm1.9227_g
Domain Number 1 Region: 115-193
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000139
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 356-437
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000482
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Weak hits

Sequence:  jgi|Dicsq1|173458|gm1.9227_g
Domain Number - Region: 56-99
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00789
Family Eukaryotic type KH-domain (KH-domain type I) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicsq1|173458|gm1.9227_g
Sequence length 508
Sequence
MAHDAPAPNTESTESISEPRPPSAAGDDGGILSLRALISTKDADTLTREASEGTLELEED
TEVHISEATPGAADQVLTATGTVAGVAKVYARIAARLVSPAVRASPPPSSTSSTSSPRPA
PLTLRLLAPHRHLGTLIGKHGTIIRAIEAASGARIVAHKRILPRSTERRVDVCGEAGAVG
EAVARVAGCLREAAAREETVLFEPGPAARIDDDDDARGEPVPEREPMTESVPEPEHEPAP
EPGHEQEPHAEPPAGKRARNGRRRERASNTTPKQRESEGRGEDKDKDKDKDKDKDKDKDK
DKDKDKDKDKDKDKDKDKDKGGGNGKHEDECAPGPARPSSSTSQTQTQTPEPAARETRRI
EIPADVVGYVVGRNGTNLAWIKRTAHAKIHLARAPARTRKQGEGEGGRAGSVLKVVGTAG
AVETAVALVEKRLERERRRRARGGRESQGSQEEQEEQEEEEEEEEEEKEDVQSARQVAVL
CAGLGGLYGTALTMHTALEIKFSKIQAF
Download sequence
Identical sequences R7SPU1
XP_007369338.1.3125 jgi|Dicsq1|173458|gm1.9227_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]