SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fomme1|157464|gm1.7794_g from Fomitiporia mediterranea v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fomme1|157464|gm1.7794_g
Domain Number 1 Region: 101-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000246
Family Thioltransferase 0.055
Further Details:      
 
Domain Number 2 Region: 313-396,423-442
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000455
Family UBX domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fomme1|157464|gm1.7794_g
Sequence length 485
Sequence
MLSIAKLLGSLVRILLYPLTTSLSTLQRLFIYFTTWLPSTSRRHVANDAASVADRWVREL
EEETGAIRESRLSDLNASSSASGADAQAGPGPSTLSRRNESARATRLQIPEFYLGSYENA
LREAQRDARLLCIVIVSEEHEDVPEFKRTTLVDPEFNKILRSNDFLVWGGDVRDYEASQA
SQKLGATTYPFVAFLANQPRGGSRGSTSSPVLTILSRHQGPSTPSDADLPTSDLGPTSPR
ALCIHLSNSLLPRVTPFLARLRAAHAERLAQRRLREEQDAAFARSAEADRARVLAKREEE
RRQQEEIEMQELIRVREEAERRKAQDEKEEREKNRLLWYRYARRSLLPPEAAPGKGSIRV
GVRFPDGRLQVRHFSPSDSVTSLYVFVASQLIPKEHAPAEDPTSPPTGFTPGEMGISGDS
WSFKLALSYPRREVPWVKSTPLSNIDGLKGGAQLVVESIPGHALIPGSNAQSQGDGDSDY
DTEEE
Download sequence
Identical sequences jgi|Fomme1|157464|gm1.7794_g XP_007267664.1.56834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]