SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi1|89197|gm1.7288_g from Fomitopsis pinicolav1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi1|89197|gm1.7288_g
Domain Number 1 Region: 457-496
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000405
Family SMI1/KNR4-like 0.01
Further Details:      
 
Domain Number 2 Region: 60-137
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.00000471
Family DJ-1/PfpI 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi1|89197|gm1.7288_g
Sequence length 624
Sequence
MSGVSFKVVVLVLGELDEASYLLLDTLDTRKDATYLCKDRSHINEIRQSIQQGEVYIIEE
YIQQRRKENFGLILIPGLKGATQFDSSGLVSTINALSHDEVNIIAAGTGRLVLAASGLLK
ERHASSASLRLDDHYASLAKSWQDVEIIRLFWTANDSATTLRSLAFLYKAAWKGDIISEF
PVYVFESYRLGDTTAVEPAKAAVATPPTAPGAELARQIANTPRADAKTLLDSVASFAVRL
GLEGHVSACDTVILSLLSVFPNLYTDLGTPSIMPLELIWERVGKRPAVPWEVALEDVNAW
DRVVRENYHLPPDQDREDILESLKARVSLGRDWSLYPYSLAGAVVMALDAGWMDEARCWM
HKLVQDALSLEAIWILELGRCRSLVDFSVSGVVAEITGHSASDAEQDAAAIRQALEAFSE
TSIEAEERQRSNSARFAAAAWPTLVKMLDALKLEDYEAALRPPASPSAVRAAEERLGVEL
PADYKEFLLITNGLEMLSIDAPALKPVEELCWETPEELGLDWMRVSLGCEVDASEEEQLP
AMNRVLVLSDGGEESMWYVEPDVVGQAAQVLKTMGRSDELVGPSGWWIVFYIPWVPEIRW
YKSFRGYVQYLAQESEKAGGTLAT
Download sequence
Identical sequences S8E2B0
jgi|Fompi3|89197|Fompi1.gm1.7288_g jgi|Fompi1|89197|gm1.7288_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]