SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi1|89198|gm1.7289_g from Fomitopsis pinicolav1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi1|89198|gm1.7289_g
Domain Number 1 Region: 69-208
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.00000000000371
Family DJ-1/PfpI 0.059
Further Details:      
 
Domain Number 2 Region: 514-624
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000222
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi1|89198|gm1.7289_g
Sequence length 678
Sequence
MMEILKAFYGMPREEEEKEEGQLNSRGLWLLRVLSSESPASWRLDLHERYSLLGDVARGV
SVNTSPDALLPLDRLRIRQESTYVTVQDESRDALSHLNIGQANILSVTSFLSGARIESYD
LLFVPGTRDAAHVAPEVAGDAIRRIFHDRMNAIATGNARIALAASGLLRDRVASSDCLQL
TDTYIERARAWDVETRIVRDGGLWTANDDPETLTTLAILYKASRHYTIGGVFPLSVWDKY
FGGSDDEPHRLPPTSSVPASRTSGDDLAAELGGLSLSDDSQEIADLIFHFAIRLALEGYV
DQCNSLLTSLFIISPNAMENLGAPCMRPIEFVWESFDARPAVPWNSPSREDLDQWDREYR
NIHHLPPDEDREDILESIKLRISMSDDWLLTPYTLSGAVVMALDAGWNDQAREWILKLVQ
DAYEIDSNHVWASRIARWRPLAHFCKAGIVAEVTGRTPEQADHDAEAVKRAINSLRSSST
TSRTEQRESSVPRFADLAWDVLVPMLNVLKWEQHETLLKPPASSAAIRDAEERLGITLPE
DYKQFLLVSNGIEFMPSIDAPGFRAIEALKWETAEELGLDEFRVDLGCKTDPGEYERLPK
MARVLVISDDSEETVWFVDPATAREAIHVLRDEGRSDDVTGQPGWRAVFWANYLTELEWL
PSFRGYMERLAEKAEKAK
Download sequence
Identical sequences S8E3E7
jgi|Fompi1|89198|gm1.7289_g jgi|Fompi3|1050800|gm1.6480_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]