SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Hanpo2|16354|fgenesh1_kg.3_#_385_#_isotig01771 from Hansenula polymorpha v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hanpo2|16354|fgenesh1_kg.3_#_385_#_isotig01771
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.09e-34
Family Chaperone J-domain 0.00016
Further Details:      
 
Domain Number 2 Region: 253-332
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.28e-18
Family HSP40/DnaJ peptide-binding domain 0.000059
Further Details:      
 
Domain Number 3 Region: 111-144,208-251
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.57e-18
Family HSP40/DnaJ peptide-binding domain 0.00025
Further Details:      
 
Domain Number 4 Region: 136-204
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 3.53e-17
Family DnaJ/Hsp40 cysteine-rich domain 0.0000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Hanpo2|16354|fgenesh1_kg.3_#_385_#_isotig01771
Sequence length 402
Sequence
MVKDTKLYDILGVSPDATDAQLKKAYRLGALKHHPDKNPSPEAAEKFKEISAAYEILSDP
EKRDLYDQYGEEGLSGGGAGGMNGADIFSQFFGGFGGFGQRGPTGPQRGKDIKHTISCTL
EELYKGKTTKLALNKTVLCSSCKGKGGKDVKKCSSCDGTGMKFVTRQMGPMIQRFQTTCD
VCHGEGDIISPKDRCQTCKGKKVSNERKILEVHIDPGMQAGQRVVFSGEGDQLPDIIPGD
VIFVIDEKKHDTFRRQGHDLFYDAKIDLLTALAGGAFAIKHLSGEYLKIDIIPGEVISPG
SVKVIEEKGMPIPRHGGYGNLFVNFEVIFPPKGFATEEQLAALEKILPPRPALNIPKNAV
VDDSCVLTDVDPIKHGQRRNRSYDEDNDEDEDGQPGVQCAQQ
Download sequence
Identical sequences A0A1B7SK55
XP_018211782.1.52233 jgi|Hanpo2|16354|fgenesh1_kg.3_#_385_#_isotig01771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]