SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|558675863|ref|YP_008812571.1| from Pseudomonas aeruginosa PA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|558675863|ref|YP_008812571.1|
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 1.2e-47
Family PA0094-like 0.0000000692
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|558675863|ref|YP_008812571.1|
Sequence length 144
Comment hypothetical protein PA1S_gp3608 [Pseudomonas aeruginosa PA1]
Sequence
MTLYRLHEADLEIPDAWQDQSINIFKLPASGPAREASFVISRDASQGDAPFADYVARQLE
NAEKQLPGFKLHKRWDINIHGHAAVLLDYQWQREGRDLMLRQVFIERRPAVLITTLTTTP
ADLPHHEPAWKQAMQTLVPRPTPS
Download sequence
Identical sequences A0A072ZSG1 A0A0E1AML7 A0A0H2ZJ35 A0A0H3QP99 A0A157WWZ2 A0A1C7BNJ8 A0A1F0J097 A0A1G5GQK2 A0A1S1C7U3 Q9I738 V6A7I5
gi|568306835|ref|YP_008979104.1| 208963.PA14_01150 208964.PA0094 557722.PLES_00951 gi|478476297|ref|YP_007706948.1| gi|558666448|ref|YP_008803158.1| gi|558669512|ref|YP_008806222.1| gi|564949989|ref|YP_008882559.1| gi|392981508|ref|YP_006480095.1| gi|514407721|ref|YP_008130563.1| gi|568151279|ref|YP_008940224.1| gi|558672799|ref|YP_008809507.1| gi|558675863|ref|YP_008812571.1| APC22056 gi|386063072|ref|YP_005978376.1| gi|218888839|ref|YP_002437703.1| gi|15595292|ref|NP_248784.1| NP_248784.1.87394 WP_003083692.1.100100 WP_003083692.1.100179 WP_003083692.1.100276 WP_003083692.1.100278 WP_003083692.1.100394 WP_003083692.1.100456 WP_003083692.1.100469 WP_003083692.1.100473 WP_003083692.1.100523 WP_003083692.1.100654 WP_003083692.1.100723 WP_003083692.1.100742 WP_003083692.1.100777 WP_003083692.1.100786 WP_003083692.1.100808 WP_003083692.1.100809 WP_003083692.1.100872 WP_003083692.1.100983 WP_003083692.1.101021 WP_003083692.1.101090 WP_003083692.1.101269 WP_003083692.1.101340 WP_003083692.1.101590 WP_003083692.1.101642 WP_003083692.1.101712 WP_003083692.1.101739 WP_003083692.1.10174 WP_003083692.1.101781 WP_003083692.1.101809 WP_003083692.1.10185 WP_003083692.1.101863 WP_003083692.1.101871 WP_003083692.1.10202 WP_003083692.1.10204 WP_003083692.1.10228 WP_003083692.1.10248 WP_003083692.1.10257 WP_003083692.1.10271 WP_003083692.1.1037 WP_003083692.1.10407 WP_003083692.1.10419 WP_003083692.1.10457 WP_003083692.1.10468 WP_003083692.1.10477 WP_003083692.1.10482 WP_003083692.1.10513 WP_003083692.1.10529 WP_003083692.1.10548 WP_003083692.1.10575 WP_003083692.1.10636 WP_003083692.1.10684 WP_003083692.1.10856 WP_003083692.1.10895 WP_003083692.1.10901 WP_003083692.1.10949 WP_003083692.1.11026 WP_003083692.1.11058 WP_003083692.1.1107 WP_003083692.1.1109 WP_003083692.1.11130 WP_003083692.1.11178 WP_003083692.1.11318 WP_003083692.1.11381 WP_003083692.1.11388 WP_003083692.1.11410 WP_003083692.1.11417 WP_003083692.1.11454 WP_003083692.1.11568 WP_003083692.1.11569 WP_003083692.1.1183 WP_003083692.1.1187 WP_003083692.1.11943 WP_003083692.1.12018 WP_003083692.1.12081 WP_003083692.1.12120 WP_003083692.1.12150 WP_003083692.1.12208 WP_003083692.1.12240 WP_003083692.1.12302 WP_003083692.1.1238 WP_003083692.1.12530 WP_003083692.1.12547 WP_003083692.1.12561 WP_003083692.1.12657 WP_003083692.1.12660 WP_003083692.1.12670 WP_003083692.1.12687 WP_003083692.1.12744 WP_003083692.1.12797 WP_003083692.1.12838 WP_003083692.1.12890 WP_003083692.1.12930 WP_003083692.1.12934 WP_003083692.1.12980 WP_003083692.1.13057 WP_003083692.1.13077 WP_003083692.1.13085 WP_003083692.1.13232 WP_003083692.1.13242 WP_003083692.1.13266 WP_003083692.1.13315 WP_003083692.1.13364 WP_003083692.1.13407 WP_003083692.1.13529 WP_003083692.1.13642 WP_003083692.1.13718 WP_003083692.1.13743 WP_003083692.1.13758 WP_003083692.1.13785 WP_003083692.1.13795 WP_003083692.1.13828 WP_003083692.1.13865 WP_003083692.1.1393 WP_003083692.1.14049 WP_003083692.1.14078 WP_003083692.1.14096 WP_003083692.1.14116 WP_003083692.1.14204 WP_003083692.1.14251 WP_003083692.1.14378 WP_003083692.1.14424 WP_003083692.1.14460 WP_003083692.1.14463 WP_003083692.1.14525 WP_003083692.1.14564 WP_003083692.1.14640 WP_003083692.1.14679 WP_003083692.1.14690 WP_003083692.1.14714 WP_003083692.1.1475 WP_003083692.1.14754 WP_003083692.1.14797 WP_003083692.1.14815 WP_003083692.1.14839 WP_003083692.1.14883 WP_003083692.1.14981 WP_003083692.1.15004 WP_003083692.1.15130 WP_003083692.1.152 WP_003083692.1.15222 WP_003083692.1.15231 WP_003083692.1.15281 WP_003083692.1.15297 WP_003083692.1.15328 WP_003083692.1.15373 WP_003083692.1.15379 WP_003083692.1.15408 WP_003083692.1.15480 WP_003083692.1.15482 WP_003083692.1.15666 WP_003083692.1.15692 WP_003083692.1.15886 WP_003083692.1.15889 WP_003083692.1.15934 WP_003083692.1.16041 WP_003083692.1.16074 WP_003083692.1.16142 WP_003083692.1.16161 WP_003083692.1.16197 WP_003083692.1.162 WP_003083692.1.16239 WP_003083692.1.16267 WP_003083692.1.16279 WP_003083692.1.16419 WP_003083692.1.1646 WP_003083692.1.16660 WP_003083692.1.16694 WP_003083692.1.1670 WP_003083692.1.16751 WP_003083692.1.16782 WP_003083692.1.16788 WP_003083692.1.16801 WP_003083692.1.16808 WP_003083692.1.16811 WP_003083692.1.16895 WP_003083692.1.17022 WP_003083692.1.17108 WP_003083692.1.17155 WP_003083692.1.17177 WP_003083692.1.17189 WP_003083692.1.172 WP_003083692.1.17223 WP_003083692.1.17353 WP_003083692.1.17370 WP_003083692.1.1739 WP_003083692.1.17397 WP_003083692.1.17499 WP_003083692.1.1758 WP_003083692.1.1761 WP_003083692.1.17697 WP_003083692.1.17890 WP_003083692.1.18054 WP_003083692.1.18117 WP_003083692.1.18156 WP_003083692.1.18157 WP_003083692.1.18199 WP_003083692.1.18204 WP_003083692.1.18234 WP_003083692.1.1824 WP_003083692.1.18440 WP_003083692.1.18493 WP_003083692.1.18508 WP_003083692.1.18547 WP_003083692.1.18653 WP_003083692.1.18728 WP_003083692.1.18732 WP_003083692.1.18735 WP_003083692.1.18769 WP_003083692.1.18852 WP_003083692.1.18892 WP_003083692.1.18907 WP_003083692.1.18911 WP_003083692.1.18930 WP_003083692.1.19089 WP_003083692.1.19199 WP_003083692.1.19260 WP_003083692.1.19351 WP_003083692.1.19376 WP_003083692.1.1938 WP_003083692.1.19552 WP_003083692.1.19640 WP_003083692.1.19703 WP_003083692.1.1971 WP_003083692.1.19711 WP_003083692.1.19718 WP_003083692.1.19741 WP_003083692.1.19803 WP_003083692.1.19824 WP_003083692.1.19930 WP_003083692.1.20024 WP_003083692.1.20070 WP_003083692.1.2012 WP_003083692.1.20125 WP_003083692.1.20216 WP_003083692.1.20342 WP_003083692.1.20590 WP_003083692.1.20682 WP_003083692.1.20692 WP_003083692.1.20825 WP_003083692.1.20854 WP_003083692.1.20880 WP_003083692.1.20890 WP_003083692.1.20929 WP_003083692.1.20978 WP_003083692.1.21002 WP_003083692.1.21039 WP_003083692.1.21096 WP_003083692.1.21100 WP_003083692.1.21166 WP_003083692.1.21253 WP_003083692.1.21302 WP_003083692.1.21349 WP_003083692.1.21358 WP_003083692.1.2144 WP_003083692.1.21460 WP_003083692.1.21469 WP_003083692.1.21471 WP_003083692.1.21517 WP_003083692.1.21718 WP_003083692.1.21744 WP_003083692.1.21767 WP_003083692.1.21782 WP_003083692.1.21801 WP_003083692.1.21871 WP_003083692.1.21891 WP_003083692.1.221 WP_003083692.1.2228 WP_003083692.1.22324 WP_003083692.1.22365 WP_003083692.1.2237 WP_003083692.1.22389 WP_003083692.1.22390 WP_003083692.1.22394 WP_003083692.1.22442 WP_003083692.1.22477 WP_003083692.1.22491 WP_003083692.1.22573 WP_003083692.1.22671 WP_003083692.1.22704 WP_003083692.1.22729 WP_003083692.1.22863 WP_003083692.1.23013 WP_003083692.1.23166 WP_003083692.1.23191 WP_003083692.1.23195 WP_003083692.1.2323 WP_003083692.1.23331 WP_003083692.1.23418 WP_003083692.1.23512 WP_003083692.1.23523 WP_003083692.1.23525 WP_003083692.1.23559 WP_003083692.1.236 WP_003083692.1.23715 WP_003083692.1.23739 WP_003083692.1.23769 WP_003083692.1.23884 WP_003083692.1.23925 WP_003083692.1.23983 WP_003083692.1.24077 WP_003083692.1.24087 WP_003083692.1.24101 WP_003083692.1.24234 WP_003083692.1.24351 WP_003083692.1.24413 WP_003083692.1.24447 WP_003083692.1.24626 WP_003083692.1.2477 WP_003083692.1.24851 WP_003083692.1.24862 WP_003083692.1.24869 WP_003083692.1.24879 WP_003083692.1.24938 WP_003083692.1.24940 WP_003083692.1.25033 WP_003083692.1.25052 WP_003083692.1.25075 WP_003083692.1.251 WP_003083692.1.25109 WP_003083692.1.2511 WP_003083692.1.25142 WP_003083692.1.25179 WP_003083692.1.25191 WP_003083692.1.25271 WP_003083692.1.2529 WP_003083692.1.2530 WP_003083692.1.25328 WP_003083692.1.25344 WP_003083692.1.25477 WP_003083692.1.25600 WP_003083692.1.25641 WP_003083692.1.2572 WP_003083692.1.25834 WP_003083692.1.25903 WP_003083692.1.2596 WP_003083692.1.25964 WP_003083692.1.26010 WP_003083692.1.26025 WP_003083692.1.26042 WP_003083692.1.26159 WP_003083692.1.26301 WP_003083692.1.26334 WP_003083692.1.26489 WP_003083692.1.26592 WP_003083692.1.26604 WP_003083692.1.26681 WP_003083692.1.26682 WP_003083692.1.26705 WP_003083692.1.26740 WP_003083692.1.26816 WP_003083692.1.26841 WP_003083692.1.26906 WP_003083692.1.26967 WP_003083692.1.27028 WP_003083692.1.27073 WP_003083692.1.27107 WP_003083692.1.27211 WP_003083692.1.27218 WP_003083692.1.27259 WP_003083692.1.27288 WP_003083692.1.27549 WP_003083692.1.27687 WP_003083692.1.27783 WP_003083692.1.27825 WP_003083692.1.27837 WP_003083692.1.27858 WP_003083692.1.27939 WP_003083692.1.27966 WP_003083692.1.28057 WP_003083692.1.28064 WP_003083692.1.28136 WP_003083692.1.28175 WP_003083692.1.28193 WP_003083692.1.28258 WP_003083692.1.283 WP_003083692.1.28316 WP_003083692.1.28329 WP_003083692.1.28372 WP_003083692.1.28383 WP_003083692.1.28404 WP_003083692.1.28528 WP_003083692.1.28560 WP_003083692.1.28602 WP_003083692.1.28623 WP_003083692.1.28699 WP_003083692.1.28713 WP_003083692.1.28757 WP_003083692.1.28823 WP_003083692.1.28838 WP_003083692.1.28878 WP_003083692.1.29008 WP_003083692.1.29062 WP_003083692.1.29070 WP_003083692.1.29096 WP_003083692.1.29137 WP_003083692.1.29158 WP_003083692.1.29179 WP_003083692.1.2927 WP_003083692.1.29401 WP_003083692.1.2941 WP_003083692.1.29438 WP_003083692.1.29440 WP_003083692.1.29472 WP_003083692.1.2948 WP_003083692.1.29481 WP_003083692.1.29498 WP_003083692.1.29501 WP_003083692.1.29577 WP_003083692.1.2961 WP_003083692.1.29633 WP_003083692.1.29650 WP_003083692.1.29668 WP_003083692.1.29753 WP_003083692.1.29767 WP_003083692.1.2980 WP_003083692.1.29848 WP_003083692.1.29958 WP_003083692.1.29973 WP_003083692.1.30000 WP_003083692.1.30020 WP_003083692.1.30081 WP_003083692.1.30254 WP_003083692.1.3030 WP_003083692.1.30365 WP_003083692.1.30474 WP_003083692.1.30475 WP_003083692.1.30563 WP_003083692.1.30614 WP_003083692.1.30615 WP_003083692.1.30693 WP_003083692.1.3072 WP_003083692.1.30740 WP_003083692.1.30797 WP_003083692.1.30815 WP_003083692.1.30842 WP_003083692.1.30943 WP_003083692.1.30973 WP_003083692.1.30994 WP_003083692.1.31045 WP_003083692.1.31103 WP_003083692.1.31279 WP_003083692.1.31361 WP_003083692.1.31457 WP_003083692.1.31501 WP_003083692.1.31563 WP_003083692.1.31565 WP_003083692.1.31633 WP_003083692.1.31655 WP_003083692.1.31732 WP_003083692.1.31751 WP_003083692.1.3179 WP_003083692.1.31848 WP_003083692.1.31852 WP_003083692.1.3189 WP_003083692.1.319 WP_003083692.1.31939 WP_003083692.1.32134 WP_003083692.1.32144 WP_003083692.1.32235 WP_003083692.1.32289 WP_003083692.1.32359 WP_003083692.1.32523 WP_003083692.1.32544 WP_003083692.1.32596 WP_003083692.1.32626 WP_003083692.1.32637 WP_003083692.1.32641 WP_003083692.1.32711 WP_003083692.1.32821 WP_003083692.1.32869 WP_003083692.1.32879 WP_003083692.1.32998 WP_003083692.1.33047 WP_003083692.1.33186 WP_003083692.1.33204 WP_003083692.1.33210 WP_003083692.1.33294 WP_003083692.1.33387 WP_003083692.1.33438 WP_003083692.1.33455 WP_003083692.1.33517 WP_003083692.1.33521 WP_003083692.1.33523 WP_003083692.1.33549 WP_003083692.1.33669 WP_003083692.1.33728 WP_003083692.1.33734 WP_003083692.1.3376 WP_003083692.1.33774 WP_003083692.1.33801 WP_003083692.1.33822 WP_003083692.1.33824 WP_003083692.1.33833 WP_003083692.1.3385 WP_003083692.1.33945 WP_003083692.1.34039 WP_003083692.1.34136 WP_003083692.1.34150 WP_003083692.1.34151 WP_003083692.1.34180 WP_003083692.1.34191 WP_003083692.1.34203 WP_003083692.1.34306 WP_003083692.1.34317 WP_003083692.1.34324 WP_003083692.1.34401 WP_003083692.1.34461 WP_003083692.1.34472 WP_003083692.1.3452 WP_003083692.1.34556 WP_003083692.1.34568 WP_003083692.1.34583 WP_003083692.1.34625 WP_003083692.1.34670 WP_003083692.1.34784 WP_003083692.1.34821 WP_003083692.1.34832 WP_003083692.1.34836 WP_003083692.1.34878 WP_003083692.1.34901 WP_003083692.1.34922 WP_003083692.1.34942 WP_003083692.1.35149 WP_003083692.1.35281 WP_003083692.1.3531 WP_003083692.1.35325 WP_003083692.1.35353 WP_003083692.1.3540 WP_003083692.1.35431 WP_003083692.1.35442 WP_003083692.1.35480 WP_003083692.1.35512 WP_003083692.1.35529 WP_003083692.1.3555 WP_003083692.1.35639 WP_003083692.1.35641 WP_003083692.1.3568 WP_003083692.1.35762 WP_003083692.1.35822 WP_003083692.1.35843 WP_003083692.1.35857 WP_003083692.1.35968 WP_003083692.1.35984 WP_003083692.1.36064 WP_003083692.1.36121 WP_003083692.1.36148 WP_003083692.1.36266 WP_003083692.1.36267 WP_003083692.1.36285 WP_003083692.1.36378 WP_003083692.1.36435 WP_003083692.1.36487 WP_003083692.1.36521 WP_003083692.1.3653 WP_003083692.1.36608 WP_003083692.1.3662 WP_003083692.1.36665 WP_003083692.1.37050 WP_003083692.1.37172 WP_003083692.1.37208 WP_003083692.1.37216 WP_003083692.1.373 WP_003083692.1.37319 WP_003083692.1.37416 WP_003083692.1.3742 WP_003083692.1.37500 WP_003083692.1.37512 WP_003083692.1.37571 WP_003083692.1.3768 WP_003083692.1.37698 WP_003083692.1.37703 WP_003083692.1.3773 WP_003083692.1.3781 WP_003083692.1.37818 WP_003083692.1.37826 WP_003083692.1.3785 WP_003083692.1.3792 WP_003083692.1.38003 WP_003083692.1.38023 WP_003083692.1.38060 WP_003083692.1.38087 WP_003083692.1.38186 WP_003083692.1.3821 WP_003083692.1.38319 WP_003083692.1.3833 WP_003083692.1.38335 WP_003083692.1.38337 WP_003083692.1.38406 WP_003083692.1.38430 WP_003083692.1.38450 WP_003083692.1.38502 WP_003083692.1.38505 WP_003083692.1.38587 WP_003083692.1.38657 WP_003083692.1.38706 WP_003083692.1.38727 WP_003083692.1.38816 WP_003083692.1.38834 WP_003083692.1.38932 WP_003083692.1.39046 WP_003083692.1.39088 WP_003083692.1.39122 WP_003083692.1.39345 WP_003083692.1.3943 WP_003083692.1.39452 WP_003083692.1.39458 WP_003083692.1.39704 WP_003083692.1.39765 WP_003083692.1.39811 WP_003083692.1.39920 WP_003083692.1.39949 WP_003083692.1.3998 WP_003083692.1.39989 WP_003083692.1.40059 WP_003083692.1.40135 WP_003083692.1.40213 WP_003083692.1.40237 WP_003083692.1.40271 WP_003083692.1.40419 WP_003083692.1.40442 WP_003083692.1.40513 WP_003083692.1.40541 WP_003083692.1.40546 WP_003083692.1.4058 WP_003083692.1.40595 WP_003083692.1.40703 WP_003083692.1.40874 WP_003083692.1.40950 WP_003083692.1.40984 WP_003083692.1.40994 WP_003083692.1.41110 WP_003083692.1.41137 WP_003083692.1.41199 WP_003083692.1.41291 WP_003083692.1.41384 WP_003083692.1.41412 WP_003083692.1.41429 WP_003083692.1.41492 WP_003083692.1.41502 WP_003083692.1.4156 WP_003083692.1.41618 WP_003083692.1.41624 WP_003083692.1.41625 WP_003083692.1.41692 WP_003083692.1.41725 WP_003083692.1.41773 WP_003083692.1.41846 WP_003083692.1.41871 WP_003083692.1.41939 WP_003083692.1.4196 WP_003083692.1.42 WP_003083692.1.42019 WP_003083692.1.42041 WP_003083692.1.42259 WP_003083692.1.42294 WP_003083692.1.42316 WP_003083692.1.42388 WP_003083692.1.42411 WP_003083692.1.42423 WP_003083692.1.42463 WP_003083692.1.42499 WP_003083692.1.42508 WP_003083692.1.42690 WP_003083692.1.42696 WP_003083692.1.42723 WP_003083692.1.4273 WP_003083692.1.42754 WP_003083692.1.42778 WP_003083692.1.42789 WP_003083692.1.42854 WP_003083692.1.42856 WP_003083692.1.42870 WP_003083692.1.42917 WP_003083692.1.42946 WP_003083692.1.42952 WP_003083692.1.42972 WP_003083692.1.42973 WP_003083692.1.43024 WP_003083692.1.43026 WP_003083692.1.43106 WP_003083692.1.43107 WP_003083692.1.43212 WP_003083692.1.43286 WP_003083692.1.43315 WP_003083692.1.43326 WP_003083692.1.43330 WP_003083692.1.43356 WP_003083692.1.4348 WP_003083692.1.43593 WP_003083692.1.43603 WP_003083692.1.43662 WP_003083692.1.43673 WP_003083692.1.43756 WP_003083692.1.43783 WP_003083692.1.43802 WP_003083692.1.4381 WP_003083692.1.43811 WP_003083692.1.4398 WP_003083692.1.43998 WP_003083692.1.44046 WP_003083692.1.44094 WP_003083692.1.44213 WP_003083692.1.44269 WP_003083692.1.44373 WP_003083692.1.44434 WP_003083692.1.44486 WP_003083692.1.44552 WP_003083692.1.44563 WP_003083692.1.44725 WP_003083692.1.44739 WP_003083692.1.44760 WP_003083692.1.44804 WP_003083692.1.44870 WP_003083692.1.4493 WP_003083692.1.45063 WP_003083692.1.45090 WP_003083692.1.45202 WP_003083692.1.4522 WP_003083692.1.45228 WP_003083692.1.45312 WP_003083692.1.4532 WP_003083692.1.45328 WP_003083692.1.45353 WP_003083692.1.45358 WP_003083692.1.45478 WP_003083692.1.45485 WP_003083692.1.45604 WP_003083692.1.45611 WP_003083692.1.45635 WP_003083692.1.45678 WP_003083692.1.45700 WP_003083692.1.45711 WP_003083692.1.45723 WP_003083692.1.45818 WP_003083692.1.45920 WP_003083692.1.45934 WP_003083692.1.45946 WP_003083692.1.45961 WP_003083692.1.46010 WP_003083692.1.46032 WP_003083692.1.46093 WP_003083692.1.46152 WP_003083692.1.46200 WP_003083692.1.46306 WP_003083692.1.4640 WP_003083692.1.46623 WP_003083692.1.46787 WP_003083692.1.46826 WP_003083692.1.46846 WP_003083692.1.46866 WP_003083692.1.46885 WP_003083692.1.46935 WP_003083692.1.4699 WP_003083692.1.47150 WP_003083692.1.47155 WP_003083692.1.47158 WP_003083692.1.47251 WP_003083692.1.4726 WP_003083692.1.47296 WP_003083692.1.47374 WP_003083692.1.47480 WP_003083692.1.47527 WP_003083692.1.47551 WP_003083692.1.47598 WP_003083692.1.47645 WP_003083692.1.47774 WP_003083692.1.47930 WP_003083692.1.48024 WP_003083692.1.48094 WP_003083692.1.48141 WP_003083692.1.48172 WP_003083692.1.48178 WP_003083692.1.48321 WP_003083692.1.4836 WP_003083692.1.48382 WP_003083692.1.48413 WP_003083692.1.48472 WP_003083692.1.48545 WP_003083692.1.48576 WP_003083692.1.48579 WP_003083692.1.48747 WP_003083692.1.48810 WP_003083692.1.48840 WP_003083692.1.48851 WP_003083692.1.48870 WP_003083692.1.49108 WP_003083692.1.4913 WP_003083692.1.49135 WP_003083692.1.49244 WP_003083692.1.49266 WP_003083692.1.49277 WP_003083692.1.49286 WP_003083692.1.49293 WP_003083692.1.49360 WP_003083692.1.49416 WP_003083692.1.49500 WP_003083692.1.49566 WP_003083692.1.49806 WP_003083692.1.49833 WP_003083692.1.49842 WP_003083692.1.49922 WP_003083692.1.49976 WP_003083692.1.49988 WP_003083692.1.50180 WP_003083692.1.50222 WP_003083692.1.50232 WP_003083692.1.50242 WP_003083692.1.50450 WP_003083692.1.50567 WP_003083692.1.50653 WP_003083692.1.50665 WP_003083692.1.50668 WP_003083692.1.50682 WP_003083692.1.50691 WP_003083692.1.50734 WP_003083692.1.50814 WP_003083692.1.50922 WP_003083692.1.50967 WP_003083692.1.50989 WP_003083692.1.51141 WP_003083692.1.51173 WP_003083692.1.51183 WP_003083692.1.51267 WP_003083692.1.51273 WP_003083692.1.51472 WP_003083692.1.51501 WP_003083692.1.51538 WP_003083692.1.51549 WP_003083692.1.51585 WP_003083692.1.51682 WP_003083692.1.51727 WP_003083692.1.51733 WP_003083692.1.51847 WP_003083692.1.51889 WP_003083692.1.51917 WP_003083692.1.51928 WP_003083692.1.51937 WP_003083692.1.51943 WP_003083692.1.51957 WP_003083692.1.51976 WP_003083692.1.52043 WP_003083692.1.52146 WP_003083692.1.52152 WP_003083692.1.5226 WP_003083692.1.52326 WP_003083692.1.52334 WP_003083692.1.5235 WP_003083692.1.52355 WP_003083692.1.52372 WP_003083692.1.52403 WP_003083692.1.52449 WP_003083692.1.52500 WP_003083692.1.52591 WP_003083692.1.5260 WP_003083692.1.52690 WP_003083692.1.52697 WP_003083692.1.52728 WP_003083692.1.52810 WP_003083692.1.52850 WP_003083692.1.5289 WP_003083692.1.52939 WP_003083692.1.5294 WP_003083692.1.53070 WP_003083692.1.53267 WP_003083692.1.53287 WP_003083692.1.53371 WP_003083692.1.53427 WP_003083692.1.53486 WP_003083692.1.53530 WP_003083692.1.53586 WP_003083692.1.53663 WP_003083692.1.53726 WP_003083692.1.53826 WP_003083692.1.5388 WP_003083692.1.53946 WP_003083692.1.53948 WP_003083692.1.53951 WP_003083692.1.54076 WP_003083692.1.54078 WP_003083692.1.54090 WP_003083692.1.54133 WP_003083692.1.54140 WP_003083692.1.54146 WP_003083692.1.5420 WP_003083692.1.54248 WP_003083692.1.5427 WP_003083692.1.54293 WP_003083692.1.54354 WP_003083692.1.54462 WP_003083692.1.54497 WP_003083692.1.54571 WP_003083692.1.54742 WP_003083692.1.54974 WP_003083692.1.55 WP_003083692.1.55318 WP_003083692.1.55347 WP_003083692.1.55387 WP_003083692.1.55400 WP_003083692.1.55445 WP_003083692.1.55478 WP_003083692.1.55543 WP_003083692.1.55813 WP_003083692.1.56013 WP_003083692.1.56145 WP_003083692.1.56171 WP_003083692.1.56187 WP_003083692.1.56188 WP_003083692.1.56196 WP_003083692.1.56229 WP_003083692.1.56348 WP_003083692.1.56452 WP_003083692.1.56474 WP_003083692.1.56475 WP_003083692.1.56623 WP_003083692.1.56626 WP_003083692.1.56632 WP_003083692.1.56745 WP_003083692.1.56768 WP_003083692.1.56797 WP_003083692.1.56808 WP_003083692.1.56837 WP_003083692.1.56864 WP_003083692.1.56896 WP_003083692.1.57005 WP_003083692.1.57020 WP_003083692.1.57065 WP_003083692.1.57113 WP_003083692.1.57131 WP_003083692.1.57140 WP_003083692.1.5731 WP_003083692.1.57369 WP_003083692.1.57460 WP_003083692.1.57477 WP_003083692.1.57480 WP_003083692.1.57532 WP_003083692.1.57548 WP_003083692.1.57566 WP_003083692.1.57728 WP_003083692.1.57839 WP_003083692.1.57853 WP_003083692.1.57921 WP_003083692.1.58019 WP_003083692.1.58056 WP_003083692.1.58155 WP_003083692.1.58162 WP_003083692.1.58200 WP_003083692.1.58228 WP_003083692.1.58294 WP_003083692.1.58360 WP_003083692.1.58436 WP_003083692.1.58482 WP_003083692.1.58510 WP_003083692.1.58527 WP_003083692.1.58581 WP_003083692.1.5869 WP_003083692.1.58785 WP_003083692.1.58800 WP_003083692.1.58838 WP_003083692.1.58845 WP_003083692.1.5889 WP_003083692.1.58944 WP_003083692.1.58952 WP_003083692.1.5897 WP_003083692.1.59013 WP_003083692.1.59076 WP_003083692.1.59099 WP_003083692.1.59156 WP_003083692.1.59158 WP_003083692.1.59176 WP_003083692.1.59246 WP_003083692.1.59249 WP_003083692.1.59250 WP_003083692.1.59288 WP_003083692.1.59339 WP_003083692.1.5937 WP_003083692.1.59376 WP_003083692.1.59385 WP_003083692.1.594 WP_003083692.1.59469 WP_003083692.1.59563 WP_003083692.1.59688 WP_003083692.1.59724 WP_003083692.1.59797 WP_003083692.1.59831 WP_003083692.1.59870 WP_003083692.1.59943 WP_003083692.1.60051 WP_003083692.1.60062 WP_003083692.1.60079 WP_003083692.1.60082 WP_003083692.1.60084 WP_003083692.1.60085 WP_003083692.1.60206 WP_003083692.1.60261 WP_003083692.1.60347 WP_003083692.1.60364 WP_003083692.1.60415 WP_003083692.1.60467 WP_003083692.1.60472 WP_003083692.1.60600 WP_003083692.1.60603 WP_003083692.1.60639 WP_003083692.1.60679 WP_003083692.1.607 WP_003083692.1.60850 WP_003083692.1.60910 WP_003083692.1.61122 WP_003083692.1.61191 WP_003083692.1.61222 WP_003083692.1.61288 WP_003083692.1.61299 WP_003083692.1.61366 WP_003083692.1.61431 WP_003083692.1.61493 WP_003083692.1.61549 WP_003083692.1.616 WP_003083692.1.61696 WP_003083692.1.61943 WP_003083692.1.62010 WP_003083692.1.62035 WP_003083692.1.62186 WP_003083692.1.62357 WP_003083692.1.62396 WP_003083692.1.62410 WP_003083692.1.6242 WP_003083692.1.62516 WP_003083692.1.62534 WP_003083692.1.62635 WP_003083692.1.62688 WP_003083692.1.62701 WP_003083692.1.62703 WP_003083692.1.62704 WP_003083692.1.62716 WP_003083692.1.62772 WP_003083692.1.6280 WP_003083692.1.6283 WP_003083692.1.62834 WP_003083692.1.62838 WP_003083692.1.62917 WP_003083692.1.62961 WP_003083692.1.63041 WP_003083692.1.63057 WP_003083692.1.63124 WP_003083692.1.63193 WP_003083692.1.63338 WP_003083692.1.63369 WP_003083692.1.63591 WP_003083692.1.63634 WP_003083692.1.63659 WP_003083692.1.63739 WP_003083692.1.63929 WP_003083692.1.63941 WP_003083692.1.63995 WP_003083692.1.64139 WP_003083692.1.64155 WP_003083692.1.64198 WP_003083692.1.64212 WP_003083692.1.64309 WP_003083692.1.64329 WP_003083692.1.64340 WP_003083692.1.64433 WP_003083692.1.64544 WP_003083692.1.64591 WP_003083692.1.64603 WP_003083692.1.64605 WP_003083692.1.6461 WP_003083692.1.64611 WP_003083692.1.64726 WP_003083692.1.64799 WP_003083692.1.64854 WP_003083692.1.64880 WP_003083692.1.64885 WP_003083692.1.64886 WP_003083692.1.64983 WP_003083692.1.65009 WP_003083692.1.65066 WP_003083692.1.65092 WP_003083692.1.65095 WP_003083692.1.65099 WP_003083692.1.65196 WP_003083692.1.65197 WP_003083692.1.65227 WP_003083692.1.65237 WP_003083692.1.65247 WP_003083692.1.65285 WP_003083692.1.65304 WP_003083692.1.65312 WP_003083692.1.65316 WP_003083692.1.65334 WP_003083692.1.65335 WP_003083692.1.65337 WP_003083692.1.65457 WP_003083692.1.65478 WP_003083692.1.65588 WP_003083692.1.65632 WP_003083692.1.65679 WP_003083692.1.65740 WP_003083692.1.65867 WP_003083692.1.66062 WP_003083692.1.66088 WP_003083692.1.66155 WP_003083692.1.66165 WP_003083692.1.66277 WP_003083692.1.6629 WP_003083692.1.66345 WP_003083692.1.66348 WP_003083692.1.66364 WP_003083692.1.66526 WP_003083692.1.66563 WP_003083692.1.66634 WP_003083692.1.66693 WP_003083692.1.66721 WP_003083692.1.66931 WP_003083692.1.66945 WP_003083692.1.67010 WP_003083692.1.67124 WP_003083692.1.67188 WP_003083692.1.67192 WP_003083692.1.6734 WP_003083692.1.67388 WP_003083692.1.67489 WP_003083692.1.67531 WP_003083692.1.67545 WP_003083692.1.67686 WP_003083692.1.67755 WP_003083692.1.67874 WP_003083692.1.67899 WP_003083692.1.6796 WP_003083692.1.68000 WP_003083692.1.6808 WP_003083692.1.68158 WP_003083692.1.68162 WP_003083692.1.68172 WP_003083692.1.68183 WP_003083692.1.68317 WP_003083692.1.68446 WP_003083692.1.68448 WP_003083692.1.68472 WP_003083692.1.68499 WP_003083692.1.6850 WP_003083692.1.68561 WP_003083692.1.68638 WP_003083692.1.68781 WP_003083692.1.68790 WP_003083692.1.68800 WP_003083692.1.68857 WP_003083692.1.68862 WP_003083692.1.68881 WP_003083692.1.68979 WP_003083692.1.69088 WP_003083692.1.69209 WP_003083692.1.6928 WP_003083692.1.6931 WP_003083692.1.6937 WP_003083692.1.69534 WP_003083692.1.69556 WP_003083692.1.69599 WP_003083692.1.69788 WP_003083692.1.69791 WP_003083692.1.69819 WP_003083692.1.69834 WP_003083692.1.70092 WP_003083692.1.70098 WP_003083692.1.70138 WP_003083692.1.70168 WP_003083692.1.70194 WP_003083692.1.70216 WP_003083692.1.70229 WP_003083692.1.70331 WP_003083692.1.70460 WP_003083692.1.70470 WP_003083692.1.70537 WP_003083692.1.70561 WP_003083692.1.70650 WP_003083692.1.70670 WP_003083692.1.70693 WP_003083692.1.70831 WP_003083692.1.70991 WP_003083692.1.71141 WP_003083692.1.71203 WP_003083692.1.71234 WP_003083692.1.71249 WP_003083692.1.71254 WP_003083692.1.71290 WP_003083692.1.71346 WP_003083692.1.71385 WP_003083692.1.71412 WP_003083692.1.71570 WP_003083692.1.71610 WP_003083692.1.7163 WP_003083692.1.71642 WP_003083692.1.71666 WP_003083692.1.71799 WP_003083692.1.71806 WP_003083692.1.71822 WP_003083692.1.71866 WP_003083692.1.72149 WP_003083692.1.72181 WP_003083692.1.72183 WP_003083692.1.7219 WP_003083692.1.72323 WP_003083692.1.72331 WP_003083692.1.72346 WP_003083692.1.72378 WP_003083692.1.72447 WP_003083692.1.72477 WP_003083692.1.72562 WP_003083692.1.72653 WP_003083692.1.72662 WP_003083692.1.72669 WP_003083692.1.72727 WP_003083692.1.7276 WP_003083692.1.72772 WP_003083692.1.72782 WP_003083692.1.72845 WP_003083692.1.72920 WP_003083692.1.73035 WP_003083692.1.7308 WP_003083692.1.73135 WP_003083692.1.73149 WP_003083692.1.73172 WP_003083692.1.7329 WP_003083692.1.733 WP_003083692.1.73490 WP_003083692.1.73523 WP_003083692.1.73541 WP_003083692.1.73601 WP_003083692.1.73651 WP_003083692.1.73791 WP_003083692.1.73860 WP_003083692.1.73889 WP_003083692.1.73941 WP_003083692.1.74 WP_003083692.1.74072 WP_003083692.1.74074 WP_003083692.1.7408 WP_003083692.1.74167 WP_003083692.1.74175 WP_003083692.1.74180 WP_003083692.1.74182 WP_003083692.1.74264 WP_003083692.1.74268 WP_003083692.1.74281 WP_003083692.1.74326 WP_003083692.1.74475 WP_003083692.1.74518 WP_003083692.1.7456 WP_003083692.1.74604 WP_003083692.1.74629 WP_003083692.1.74637 WP_003083692.1.74685 WP_003083692.1.74772 WP_003083692.1.74776 WP_003083692.1.74878 WP_003083692.1.74941 WP_003083692.1.74948 WP_003083692.1.74958 WP_003083692.1.7501 WP_003083692.1.75041 WP_003083692.1.75119 WP_003083692.1.75204 WP_003083692.1.75277 WP_003083692.1.75303 WP_003083692.1.75389 WP_003083692.1.75431 WP_003083692.1.7547 WP_003083692.1.75599 WP_003083692.1.75603 WP_003083692.1.75631 WP_003083692.1.7568 WP_003083692.1.75756 WP_003083692.1.75771 WP_003083692.1.75792 WP_003083692.1.75826 WP_003083692.1.75860 WP_003083692.1.75935 WP_003083692.1.75938 WP_003083692.1.75947 WP_003083692.1.76077 WP_003083692.1.76141 WP_003083692.1.76145 WP_003083692.1.76192 WP_003083692.1.76322 WP_003083692.1.76383 WP_003083692.1.76399 WP_003083692.1.76441 WP_003083692.1.76467 WP_003083692.1.76484 WP_003083692.1.76543 WP_003083692.1.7666 WP_003083692.1.76775 WP_003083692.1.76791 WP_003083692.1.76861 WP_003083692.1.76922 WP_003083692.1.76985 WP_003083692.1.77238 WP_003083692.1.77286 WP_003083692.1.77442 WP_003083692.1.77476 WP_003083692.1.77490 WP_003083692.1.77566 WP_003083692.1.77574 WP_003083692.1.77686 WP_003083692.1.77750 WP_003083692.1.77769 WP_003083692.1.7779 WP_003083692.1.77819 WP_003083692.1.77834 WP_003083692.1.78104 WP_003083692.1.78112 WP_003083692.1.78118 WP_003083692.1.78134 WP_003083692.1.78158 WP_003083692.1.78288 WP_003083692.1.78380 WP_003083692.1.78409 WP_003083692.1.78425 WP_003083692.1.78430 WP_003083692.1.78437 WP_003083692.1.78599 WP_003083692.1.78623 WP_003083692.1.78669 WP_003083692.1.78693 WP_003083692.1.78795 WP_003083692.1.788 WP_003083692.1.78926 WP_003083692.1.78947 WP_003083692.1.78954 WP_003083692.1.7899 WP_003083692.1.79003 WP_003083692.1.79007 WP_003083692.1.79053 WP_003083692.1.79060 WP_003083692.1.79177 WP_003083692.1.79193 WP_003083692.1.79256 WP_003083692.1.79279 WP_003083692.1.79286 WP_003083692.1.79357 WP_003083692.1.79364 WP_003083692.1.79429 WP_003083692.1.79431 WP_003083692.1.7945 WP_003083692.1.79507 WP_003083692.1.79601 WP_003083692.1.79631 WP_003083692.1.79699 WP_003083692.1.79754 WP_003083692.1.79862 WP_003083692.1.79883 WP_003083692.1.799 WP_003083692.1.79908 WP_003083692.1.79986 WP_003083692.1.8 WP_003083692.1.80068 WP_003083692.1.80087 WP_003083692.1.80102 WP_003083692.1.8013 WP_003083692.1.80174 WP_003083692.1.80258 WP_003083692.1.80306 WP_003083692.1.8038 WP_003083692.1.80411 WP_003083692.1.80481 WP_003083692.1.8051 WP_003083692.1.80632 WP_003083692.1.80644 WP_003083692.1.80683 WP_003083692.1.80715 WP_003083692.1.80720 WP_003083692.1.80785 WP_003083692.1.80846 WP_003083692.1.80880 WP_003083692.1.80892 WP_003083692.1.80910 WP_003083692.1.80926 WP_003083692.1.80929 WP_003083692.1.80931 WP_003083692.1.80969 WP_003083692.1.81081 WP_003083692.1.81082 WP_003083692.1.8110 WP_003083692.1.81206 WP_003083692.1.81237 WP_003083692.1.81331 WP_003083692.1.81338 WP_003083692.1.81349 WP_003083692.1.8141 WP_003083692.1.81426 WP_003083692.1.81470 WP_003083692.1.81482 WP_003083692.1.81487 WP_003083692.1.81581 WP_003083692.1.81591 WP_003083692.1.81622 WP_003083692.1.81643 WP_003083692.1.81742 WP_003083692.1.81748 WP_003083692.1.81771 WP_003083692.1.81784 WP_003083692.1.81816 WP_003083692.1.81834 WP_003083692.1.81856 WP_003083692.1.81874 WP_003083692.1.81927 WP_003083692.1.81957 WP_003083692.1.81960 WP_003083692.1.81986 WP_003083692.1.82117 WP_003083692.1.82178 WP_003083692.1.82260 WP_003083692.1.8227 WP_003083692.1.82312 WP_003083692.1.82328 WP_003083692.1.82334 WP_003083692.1.8238 WP_003083692.1.82442 WP_003083692.1.82487 WP_003083692.1.82580 WP_003083692.1.82604 WP_003083692.1.82606 WP_003083692.1.82643 WP_003083692.1.82686 WP_003083692.1.82710 WP_003083692.1.82798 WP_003083692.1.82810 WP_003083692.1.8284 WP_003083692.1.82864 WP_003083692.1.82882 WP_003083692.1.82887 WP_003083692.1.82936 WP_003083692.1.83025 WP_003083692.1.83131 WP_003083692.1.83213 WP_003083692.1.83374 WP_003083692.1.83440 WP_003083692.1.83460 WP_003083692.1.83463 WP_003083692.1.83503 WP_003083692.1.8351 WP_003083692.1.8353 WP_003083692.1.83534 WP_003083692.1.83540 WP_003083692.1.83637 WP_003083692.1.83698 WP_003083692.1.83871 WP_003083692.1.83937 WP_003083692.1.83946 WP_003083692.1.84003 WP_003083692.1.84162 WP_003083692.1.84174 WP_003083692.1.84177 WP_003083692.1.84178 WP_003083692.1.84203 WP_003083692.1.84271 WP_003083692.1.84374 WP_003083692.1.84398 WP_003083692.1.84439 WP_003083692.1.84526 WP_003083692.1.84538 WP_003083692.1.84558 WP_003083692.1.84589 WP_003083692.1.84702 WP_003083692.1.84715 WP_003083692.1.84754 WP_003083692.1.84792 WP_003083692.1.84825 WP_003083692.1.8484 WP_003083692.1.84865 WP_003083692.1.84937 WP_003083692.1.8498 WP_003083692.1.85018 WP_003083692.1.85028 WP_003083692.1.85059 WP_003083692.1.85150 WP_003083692.1.85220 WP_003083692.1.85290 WP_003083692.1.85298 WP_003083692.1.85303 WP_003083692.1.85311 WP_003083692.1.85357 WP_003083692.1.85446 WP_003083692.1.85574 WP_003083692.1.85633 WP_003083692.1.85638 WP_003083692.1.85788 WP_003083692.1.85910 WP_003083692.1.85920 WP_003083692.1.85978 WP_003083692.1.86002 WP_003083692.1.86047 WP_003083692.1.86055 WP_003083692.1.86058 WP_003083692.1.86125 WP_003083692.1.86243 WP_003083692.1.86287 WP_003083692.1.86293 WP_003083692.1.86386 WP_003083692.1.8645 WP_003083692.1.865 WP_003083692.1.86506 WP_003083692.1.86545 WP_003083692.1.86554 WP_003083692.1.86595 WP_003083692.1.86652 WP_003083692.1.86665 WP_003083692.1.867 WP_003083692.1.86708 WP_003083692.1.86733 WP_003083692.1.86774 WP_003083692.1.86780 WP_003083692.1.86785 WP_003083692.1.86796 WP_003083692.1.86813 WP_003083692.1.86947 WP_003083692.1.86970 WP_003083692.1.87163 WP_003083692.1.87182 WP_003083692.1.87183 WP_003083692.1.87316 WP_003083692.1.87390 WP_003083692.1.87435 WP_003083692.1.8749 WP_003083692.1.87547 WP_003083692.1.87648 WP_003083692.1.87763 WP_003083692.1.8785 WP_003083692.1.87877 WP_003083692.1.87888 WP_003083692.1.87970 WP_003083692.1.87975 WP_003083692.1.87981 WP_003083692.1.87987 WP_003083692.1.88004 WP_003083692.1.88152 WP_003083692.1.88308 WP_003083692.1.88360 WP_003083692.1.88517 WP_003083692.1.8852 WP_003083692.1.88540 WP_003083692.1.88550 WP_003083692.1.88578 WP_003083692.1.88605 WP_003083692.1.88679 WP_003083692.1.88680 WP_003083692.1.88750 WP_003083692.1.88796 WP_003083692.1.88900 WP_003083692.1.88949 WP_003083692.1.88969 WP_003083692.1.89083 WP_003083692.1.89098 WP_003083692.1.8911 WP_003083692.1.89234 WP_003083692.1.89245 WP_003083692.1.89266 WP_003083692.1.89276 WP_003083692.1.89330 WP_003083692.1.89409 WP_003083692.1.89434 WP_003083692.1.89440 WP_003083692.1.89480 WP_003083692.1.8949 WP_003083692.1.89523 WP_003083692.1.89610 WP_003083692.1.89669 WP_003083692.1.8976 WP_003083692.1.89867 WP_003083692.1.89868 WP_003083692.1.89886 WP_003083692.1.89992 WP_003083692.1.90024 WP_003083692.1.90056 WP_003083692.1.90110 WP_003083692.1.90141 WP_003083692.1.90150 WP_003083692.1.90189 WP_003083692.1.90224 WP_003083692.1.90225 WP_003083692.1.90268 WP_003083692.1.90272 WP_003083692.1.9056 WP_003083692.1.90655 WP_003083692.1.90940 WP_003083692.1.90999 WP_003083692.1.91012 WP_003083692.1.91093 WP_003083692.1.91161 WP_003083692.1.91204 WP_003083692.1.91236 WP_003083692.1.91336 WP_003083692.1.91360 WP_003083692.1.91392 WP_003083692.1.91416 WP_003083692.1.91431 WP_003083692.1.91438 WP_003083692.1.91467 WP_003083692.1.91563 WP_003083692.1.91796 WP_003083692.1.91803 WP_003083692.1.9182 WP_003083692.1.91838 WP_003083692.1.91860 WP_003083692.1.91862 WP_003083692.1.91882 WP_003083692.1.9191 WP_003083692.1.91938 WP_003083692.1.91943 WP_003083692.1.92175 WP_003083692.1.9219 WP_003083692.1.92314 WP_003083692.1.92321 WP_003083692.1.92357 WP_003083692.1.92454 WP_003083692.1.92587 WP_003083692.1.92589 WP_003083692.1.92624 WP_003083692.1.92630 WP_003083692.1.92642 WP_003083692.1.9272 WP_003083692.1.92769 WP_003083692.1.92839 WP_003083692.1.92847 WP_003083692.1.92894 WP_003083692.1.92924 WP_003083692.1.92930 WP_003083692.1.93001 WP_003083692.1.93122 WP_003083692.1.93130 WP_003083692.1.93144 WP_003083692.1.93196 WP_003083692.1.93250 WP_003083692.1.93446 WP_003083692.1.9349 WP_003083692.1.93493 WP_003083692.1.93498 WP_003083692.1.93520 WP_003083692.1.93547 WP_003083692.1.93562 WP_003083692.1.93568 WP_003083692.1.93797 WP_003083692.1.93848 WP_003083692.1.93889 WP_003083692.1.93897 WP_003083692.1.94031 WP_003083692.1.94078 WP_003083692.1.94136 WP_003083692.1.94174 WP_003083692.1.94211 WP_003083692.1.94218 WP_003083692.1.94243 WP_003083692.1.94285 WP_003083692.1.94288 WP_003083692.1.94333 WP_003083692.1.94349 WP_003083692.1.94422 WP_003083692.1.94434 WP_003083692.1.9444 WP_003083692.1.94450 WP_003083692.1.94742 WP_003083692.1.94814 WP_003083692.1.94818 WP_003083692.1.94856 WP_003083692.1.94874 WP_003083692.1.94881 WP_003083692.1.94896 WP_003083692.1.94897 WP_003083692.1.95018 WP_003083692.1.95025 WP_003083692.1.95056 WP_003083692.1.95132 WP_003083692.1.95207 WP_003083692.1.95217 WP_003083692.1.95305 WP_003083692.1.95324 WP_003083692.1.95354 WP_003083692.1.95359 WP_003083692.1.95460 WP_003083692.1.95488 WP_003083692.1.95638 WP_003083692.1.95745 WP_003083692.1.95751 WP_003083692.1.95774 WP_003083692.1.95782 WP_003083692.1.95959 WP_003083692.1.95994 WP_003083692.1.96008 WP_003083692.1.9604 WP_003083692.1.96041 WP_003083692.1.96058 WP_003083692.1.961 WP_003083692.1.96193 WP_003083692.1.96357 WP_003083692.1.96384 WP_003083692.1.96434 WP_003083692.1.96452 WP_003083692.1.96506 WP_003083692.1.96667 WP_003083692.1.96702 WP_003083692.1.96714 WP_003083692.1.96863 WP_003083692.1.96880 WP_003083692.1.96967 WP_003083692.1.9706 WP_003083692.1.97126 WP_003083692.1.9722 WP_003083692.1.97271 WP_003083692.1.97377 WP_003083692.1.97488 WP_003083692.1.97503 WP_003083692.1.97521 WP_003083692.1.97583 WP_003083692.1.977 WP_003083692.1.97826 WP_003083692.1.97877 WP_003083692.1.98260 WP_003083692.1.98276 WP_003083692.1.98308 WP_003083692.1.98433 WP_003083692.1.9845 WP_003083692.1.985 WP_003083692.1.98515 WP_003083692.1.98522 WP_003083692.1.98573 WP_003083692.1.98600 WP_003083692.1.98672 WP_003083692.1.98693 WP_003083692.1.98718 WP_003083692.1.98788 WP_003083692.1.9885 WP_003083692.1.98873 WP_003083692.1.98907 WP_003083692.1.98926 WP_003083692.1.98960 WP_003083692.1.98963 WP_003083692.1.99065 WP_003083692.1.99068 WP_003083692.1.99103 WP_003083692.1.99214 WP_003083692.1.99293 WP_003083692.1.99378 WP_003083692.1.99386 WP_003083692.1.99389 WP_003083692.1.99443 WP_003083692.1.99461 WP_003083692.1.9951 WP_003083692.1.99516 WP_003083692.1.99647 WP_003083692.1.99654 WP_003083692.1.99662 WP_003083692.1.99746 WP_003083692.1.99757 WP_003083692.1.99772 WP_003083692.1.99835 WP_003083692.1.9989 WP_003083692.1.99930 gi|386056165|ref|YP_005972687.1| gi|116053815|ref|YP_788252.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]