SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Punst1|88916|estExt_Genewise1.C_8_t30168 from Punctularia strigosozonata v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Punst1|88916|estExt_Genewise1.C_8_t30168
Domain Number 1 Region: 375-474,510-531
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000785
Family Ubiquitin-related 0.054
Further Details:      
 
Domain Number 2 Region: 195-283
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000192
Family Thioltransferase 0.031
Further Details:      
 
Weak hits

Sequence:  jgi|Punst1|88916|estExt_Genewise1.C_8_t30168
Domain Number - Region: 6-48
Classification Level Classification E-value
Superfamily UBA-like 0.000147
Family TAP-C domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Punst1|88916|estExt_Genewise1.C_8_t30168
Sequence length 559
Sequence
MDDLTKTQRDAVEQLQTLTNGSDADVAIEILKSAGWDVQVAAEMIFDGPSAGQSSAPGPS
RPPIEQFELDDSEQGQILPRGTPTFVTPRQSTIWTILSFPFNLLSNMLRFIFGILRIPFP
RLNFTGSLSTYRPPSGPSFGQVDPRTAADRWVRALEEETGAICATGAASGVSANGNSTGS
STLTHRHAEDDGRKSLPDFVRSSYEQALKLCEREARIGCIVLVSDEHDDVPEFKRVTLTD
PRLLQLLFDNDFVVWGGDVRDKDAWMAAQKLETTTYPFVAFVALQPQRGASRSSSTTGNM
TVLSRHQGPATPDAGPTSASKLVAHLETQLLPRVKPFLDRVRATLREREHERDLRRMQEE
AFEVAARKDRERIERRIEEERRQQREQQEREQKEREEREKKASEELEKARWQEKRGAWRR
WARRALVPPEAKKGGIRVTVRMPDGSRRIRILSPEDSLTGLYAFVDSQFLPSSQSPTDDP
TDVPQGFEPGDPGIQSQIRAVGGADSWWGFELFFAYPRKELPWAPNTKLRDIPQMNGGAQ
LVVERRPADAGDDGSDSDS
Download sequence
Identical sequences XP_007385215.1.86435 jgi|Punst1|88916|estExt_Genewise1.C_8_t30168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]