SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407463906|ref|YP_006774788.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407463906|ref|YP_006774788.1|
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000446
Family Potassium channel NAD-binding domain 0.039
Further Details:      
 
Weak hits

Sequence:  gi|407463906|ref|YP_006774788.1|
Domain Number - Region: 153-219
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 0.00476
Family UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407463906|ref|YP_006774788.1|
Sequence length 245
Comment UDP-glucose/GDP-mannose dehydrogenase [Candidatus Nitrosopumilus sp. AR2]
Sequence
MTDIILGMGEVGETLFHLLEERGFDSVGIDTDTSKCKNYSKSQKIENPEYLHVCLPGELS
EFVDVTLDWINKMEGLKSVLVHSTVKPGTTKRIQEKSEVLVLYSPIRGVHRRFLDDIKKY
TKFISSDKKNIDPKVKVDLEKRFEKVDWMSTTKTAELAKILVDTTYYGWLINYAQITKMI
CEKEGIDFDEMWKFADEIHENLGNRPKMFPGIIGGHCVIPNLNLIDNEELDMIKKINEIY
EKFKK
Download sequence
Identical sequences K0BBV4
gi|407463906|ref|YP_006774788.1| WP_014964218.1.40567 WP_014964218.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]