SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407464116|ref|YP_006774998.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|407464116|ref|YP_006774998.1|
Domain Number - Region: 207-250
Classification Level Classification E-value
Superfamily Prefoldin 0.0241
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407464116|ref|YP_006774998.1|
Sequence length 271
Comment hypothetical protein NSED_01220 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MSEEKKESEIDTKSIDDSISDKPSSDETAKAAEKTIAKAETVKAEAEIVKAEAEKVKANA
KKDDEEAKAAEEIQAAEEAIAKAEAAAKAVEDAEFAVKEALAKAEAAKAEAEAAAEAEYK
AIAAEVKAEAAAKSDYTFKRQSEEIFRREMGEPEFWLDKQDRFPRPILSADEQESLTRKA
EIFHDQTPAYVPQNVLSPEYAGVSNYERGVESFLEETKQKLEQLKNNPEATEKEIKDVEN
EIIYLESLHENFYIGMNVFRTAKGGRDKIKA
Download sequence
Identical sequences K0BCG1
WP_014964428.1.40567 WP_014964428.1.82955 gi|407464116|ref|YP_006774998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]