SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407464119|ref|YP_006775001.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407464119|ref|YP_006775001.1|
Domain Number 1 Region: 118-264
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.75e-21
Family Aromatic dioxygenase reductase-like 0.086
Further Details:      
 
Domain Number 2 Region: 3-104
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 7.74e-20
Family Ferredoxin reductase FAD-binding domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407464119|ref|YP_006775001.1|
Sequence length 280
Comment oxidoreductase FAD/NAD(P)-binding subunit [Candidatus Nitrosopumilus sp. AR2]
Sequence
MVTEMKAKVIYRELLKEDLVIIRLLPENGMPEYKTGQFLTIGLPIPAEKKIVRRAYSIAS
HPENRDYFEFVIRWVRKPLPGRVTTELFYLSVGEEVFLGEPTGAALQISDRLPNGQKDNR
RVICVGGGTGIAPFIAFAKHFHDTNDKREVIVLHGASYVDELSYKRLLTDLEMESEKRGR
DQWNFRYRAAISRPKEFFNRSWNGHVGRVESFFQPDKKTGLSPVEEMVGEELTPENTIIY
ICGYQGTIDGVIENLGPKGFVTEHEKKPDGSFGIKFESYG
Download sequence
Identical sequences K0B9A6
gi|407464119|ref|YP_006775001.1| WP_014964431.1.40567 WP_014964431.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]