SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407464433|ref|YP_006775315.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407464433|ref|YP_006775315.1|
Domain Number 1 Region: 5-230
Classification Level Classification E-value
Superfamily Aquaporin-like 1.57e-59
Family Aquaporin-like 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407464433|ref|YP_006775315.1|
Sequence length 234
Comment glycerol uptake facilitator [Candidatus Nitrosopumilus sp. AR2]
Sequence
MVNPRAYLAEAIATYGLVFFGPLSVILAVSAFGEELTTQSVLFISLGHGGAIALMVYAFG
HVSGAHINPAVTIPMIITKKIGIADGIGYIISQLIGAVAAAATLAAILPEVGAKVNFATQ
GGPSDLINNSIGSGFAIEAILTFFLVTVIFMVAVHKKATPGIQGLAIGGMVFLIHLVAVP
LTGASVNPARTFGPALISGFWEFHWLYWAAPILGGIIAGLIMNYVYTKPAEKEA
Download sequence
Identical sequences K0B8C3
WP_014964745.1.40567 WP_014964745.1.82955 gi|407464433|ref|YP_006775315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]