SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465001|ref|YP_006775883.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465001|ref|YP_006775883.1|
Domain Number 1 Region: 118-214
Classification Level Classification E-value
Superfamily Cyclin-like 2.33e-23
Family Transcription factor IIB (TFIIB), core domain 0.00038
Further Details:      
 
Domain Number 2 Region: 214-301
Classification Level Classification E-value
Superfamily Cyclin-like 1.1e-20
Family Transcription factor IIB (TFIIB), core domain 0.00073
Further Details:      
 
Domain Number 3 Region: 7-55
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 5.55e-16
Family Transcriptional factor domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407465001|ref|YP_006775883.1|
Sequence length 303
Comment transcription factor TFIIB cyclin-related protein [Candidatus Nitrosopumilus sp. AR2]
Sequence
MLKNQMIAGPKCPSCGDKKMVTDQTTGELFCSKCGLVVTDKIADTGAEWRSFSNEEGNKA
RTGAGTSLTMHDMGLSTVIGAANKDATGKPLSASVKSSIERLRTWDSRSQAHSSADRNLR
QALNEMDKLKDKLALTDAVIEKAAYIYRKAMEKKLVRGRSIQGLVAACLYASCRNTETPR
TLDDIAKGINIRRKDVARCYRLIFRELELKMPVVDPVKGVSRIASIAELSEKSKRKAIAI
LNQAKEIGMVAGKDPMGIAAAALYLACISTGEVKSQKDISIASGVTEVTIRNRCSGLRKM
LND
Download sequence
Identical sequences K0BF80
WP_014965312.1.40567 WP_014965312.1.82955 gi|407465001|ref|YP_006775883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]