SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465071|ref|YP_006775953.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|407465071|ref|YP_006775953.1|
Domain Number - Region: 15-39
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000365
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407465071|ref|YP_006775953.1|
Sequence length 55
Comment hypothetical protein NSED_06045 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MGLFKRKKDDENKTKCDVCGTELHDPERLKKHMKKAHGNVPAKKMDPNAGDGGTW
Download sequence
Identical sequences K0BFE0
gi|407465071|ref|YP_006775953.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]