SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465172|ref|YP_006776054.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465172|ref|YP_006776054.1|
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily RING/U-box 2.24e-23
Family Zf-UBP 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407465172|ref|YP_006776054.1|
Sequence length 84
Comment zinc finger UBP-type protein [Candidatus Nitrosopumilus sp. AR2]
Sequence
MAKECEHFLQEKNVSQNRKSCEECEKEHLPVVALRMCLTCGHVGCCDSSIGKHATKHFEE
TGHPVMQAVPENIWKWCYIHKEYY
Download sequence
Identical sequences K0BDF7
WP_014965482.1.40567 WP_014965482.1.82955 gi|407465172|ref|YP_006776054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]