SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465249|ref|YP_006776131.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465249|ref|YP_006776131.1|
Domain Number 1 Region: 17-62
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.00000115
Family Zn-finger domain of Sec23/24 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407465249|ref|YP_006776131.1|
Sequence length 87
Comment hypothetical protein NSED_06955 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MADYDPDGRLLICRAKQLDEIPSRCYNCDSDDLQQIMVHVEGGSWICMTCNYLNSYEPSM
RLTKNMPFSMVNLGTDEIAFVDGWDFE
Download sequence
Identical sequences K0BCI7
gi|407465249|ref|YP_006776131.1| WP_014965559.1.40567 WP_014965559.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]