SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465332|ref|YP_006776214.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465332|ref|YP_006776214.1|
Domain Number 1 Region: 3-229
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.69e-46
Family FGase-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407465332|ref|YP_006776214.1|
Sequence length 256
Comment N-formylglutamate amidohydrolase [Candidatus Nitrosopumilus sp. AR2]
Sequence
MTKLPVLLSIPHGGARKPTELDGHLSITNKDLFDDSDPFVIELYDLGDKVQRVIKTDIAR
AFVDLNRSLQDMPPENPDGLIKSMTCYKKPIYTNGKAPDDNLCNLLIELYYLPYHRSIKK
SIEELDLQLCLDCHSMASIAPGISPDGNKNPRPKFCLSNNDGQTSSQEMIELLADSISKS
YSIDRDEIYLNDPFHGGYITRTYGNNPYPWIQVEMNRDMYLRSPWYDEDALTVDDNYLQK
LNKQFENSLELFFSKI
Download sequence
Identical sequences K0BE03
gi|407465332|ref|YP_006776214.1| WP_014965642.1.40567 WP_014965642.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]