SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465357|ref|YP_006776239.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465357|ref|YP_006776239.1|
Domain Number 1 Region: 12-186
Classification Level Classification E-value
Superfamily AF1531-like 1.24e-66
Family AF1531-like 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407465357|ref|YP_006776239.1|
Sequence length 188
Comment hypothetical protein NSED_07525 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MYRAQPPARKYEEYAYVLDFNTRGKSSTVKGREGIIITAIGEDRLTLLEILGIPNSTFEI
GEKIYIGKEGRTKVLSVLGKMDYARISSSAQSELESVVEKIVTNNEEKFVTYLNNAQPLT
PRIHALELIPGIGKTYMKTMLEEREQKKFESYQDLQDRVGFKEPIKHISERILDEITGES
RMNLFVKR
Download sequence
Identical sequences K0BE34
WP_014965667.1.40567 WP_014965667.1.82955 gi|407465357|ref|YP_006776239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]