SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465399|ref|YP_006776281.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465399|ref|YP_006776281.1|
Domain Number 1 Region: 414-572
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.55e-50
Family DNA gyrase/MutL, second domain 0.00000487
Further Details:      
 
Domain Number 2 Region: 16-227
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.54e-28
Family DNA gyrase/MutL, N-terminal domain 0.0000422
Further Details:      
 
Domain Number 3 Region: 358-409
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.0000306
Family Topoisomerase VI-B subunit middle domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407465399|ref|YP_006776281.1|
Sequence length 622
Comment DNA topoisomerase VI subunit B [Candidatus Nitrosopumilus sp. AR2]
Sequence
MSSIKEKFNQISPSEFFYSNRDLAGFSNPTRSLYTAVREFVENALDACDQKGILPDVHLT
IKAVEPEKPDPKPYILTVKDNGPGIDAEHIPLAFGTVLYGSKFGLKQARGMFGLGATMAI
LYGQITTNKPVTVKSSVDGETQHIFELLLDIQKNKPVIVQHITKEVSKKGLSVSICLEGD
YSKAGNKIRDYVYETSLITPYASITFDDPKGQKFSHPRFVKEIPPPPTIIRPHPHGIDVE
RIRRMIVESQFEIPTIDDAMIEKVRKDLGLSAKNLSFTGIMDKAKKKWKTLPRQVRVVIA
LMSFLKMDFDKLNKIRIEDIDMPNKKLFYWDFGDSQSKSIDMDPESQYYKQLTNTVQGEP
LTTFLTKRFQRIGPTTAVKFAEFAGFKPEKRMGTLSNQELVHLSDSLQKFEDFMAPDSTC
LAPLGEEPLEKGIKKFFNPDFTAVVQRPPSAYSGFPFIIEMGIAYGGDIKSGGPHVYRYA
NRIPLLYDEGSDVVLKVVNDTDWGRYKVKGDPPFIIVSHICSTRIPYKTAGKENVADRPE
IERELRLALQFLSRKLAAYMSKRGQADMAKKRANLYAKYIPLIAEFCTELSGKKKAPNYQ
KLLEENAVESKKIEEEKEIENN
Download sequence
Identical sequences K0BD06
WP_014965709.1.40567 WP_014965709.1.82955 gi|407465399|ref|YP_006776281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]