SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465418|ref|YP_006776300.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465418|ref|YP_006776300.1|
Domain Number 1 Region: 33-156
Classification Level Classification E-value
Superfamily THUMP domain-like 0.00000000000296
Family Minimal THUMP 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407465418|ref|YP_006776300.1|
Sequence length 173
Comment THUMP domain-containing protein [Candidatus Nitrosopumilus sp. AR2]
Sequence
MNLIVTCPRHLEPETEEELMSILGEFGDSDVKVSITNMSGILTAETQLDPIEVVKKIKDM
LLDEPWSVRYCKRIIPIQKVIESNIDEIEKSVVELSSQILEDETYRISIEKRNSDLSSKE
IITKIADKIKNKVSLEFPDKILLVEILGNETGVSVLKKSDILSTEKTKRSMSE
Download sequence
Identical sequences K0BB10
gi|407465418|ref|YP_006776300.1| WP_014965728.1.40567 WP_014965728.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]