SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407465514|ref|YP_006776396.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465514|ref|YP_006776396.1|
Domain Number 1 Region: 116-416
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.64e-91
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily tRNA-binding arm 3.5e-26
Family Seryl-tRNA synthetase (SerRS) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407465514|ref|YP_006776396.1|
Sequence length 421
Comment seryl-tRNA synthetase [Candidatus Nitrosopumilus sp. AR2]
Sequence
MLDPKLIKEKPQIIRDMLKARSVDFNLDGLIESDQKRREFIIKTDELRKKKNQVALEISQ
KKKAGEDASLILSEMKNVSAELAKLESEQENIENTYSRLALTIPNLVHDSVPIGTDESAN
QEVRKWGNVPNFDFKINDHIDISENLDLVDLERAAKVAGARFYYLKNDLVRLNQSLIHYG
LDFLAKKEYSLVQPPYMINRESMEGAVIADDFEEVIYKVEDEDLYMIGTSEHAMAAMRSK
EILEGKDLPLRYAGVSPCFRKEAGAHGRDQKGIFRVHQFDKIEQFVFSRPEDSWKEHERM
LSVAEEFYQNLEIPHRVMLLSTGDMGKVSAKTYDIEAWMAGQNAYREIVSCSNCLDYQAR
RLKIRFRDKTNEDTQYVHTLNSTLIATTRILVSIMENFQTKDGHIRIPSVLQNYMGNQKE
I
Download sequence
Identical sequences K0BDD8
gi|407465514|ref|YP_006776396.1| WP_014965823.1.40567 WP_014965823.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]