SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465519|ref|YP_006776401.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465519|ref|YP_006776401.1|
Domain Number 1 Region: 348-499
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000341
Family Integrin A (or I) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407465519|ref|YP_006776401.1|
Sequence length 520
Comment hypothetical protein NSED_08335 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MQAIQLQNDSLVEIATFLVRRWSEKENIIVEISDKTETKTRLKENKVILTPLEKRIGNDF
QKYRQFRTSLWYEAMRIKYCKKILSNDHAFGFILNTMETQRVEQLGRKIWKGMDAEIIFN
YTYMLVARPQLHTVYGKARIVEAFYQYFMFGVIKGEIQSSNFEKIKKATTFAKEIVNKAI
DENRDTSWIEKNVSEIIKILDIDSLLTIPVSLPFMKAGMALSEEELLKVLKIISKNKEGD
LGTMDPKSVIRGDDVYDEYKVLLDENKKTENKGLAAETVGIQTPSTKNIDETTIYDLGLI
NGLKMKFKEWKSGWKEQHLRSGDEFDEESYIEGNEPFFTDVKKSIKTKIVILLDHSSSIA
SDAIEYKKATLALCEVLSFLKVKFAVYAFSTENRSMVCWSIKPENVKWNSITAKRLAQIV
ANGSTPLAEVYDKMFPILQSKRPDIFLTLTDGEPSDPDAVRNMTKSFKGLGIRMVALGLG
PNTVRATTIANNLKHLGYEKTMAVSRLNDIPNKVISILDG
Download sequence
Identical sequences K0BDE2
WP_014965828.1.40567 WP_014965828.1.82955 gi|407465519|ref|YP_006776401.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]