SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465551|ref|YP_006776433.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|407465551|ref|YP_006776433.1|
Domain Number - Region: 141-212
Classification Level Classification E-value
Superfamily E set domains 0.0028
Family Filamin repeat (rod domain) 0.019
Further Details:      
 
Domain Number - Region: 45-119
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0373
Family Cna protein B-type domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407465551|ref|YP_006776433.1|
Sequence length 322
Comment hypothetical protein NSED_08495 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MKFKILLSLFFVMMLMAAPNSFAELELFTNSKVYSPEHTLQVYGKGLPEENLIIRIFAPD
ESIAKFDQITTNEDGSFNYGLLTWPEPSTNFPYGTYTVELISTEQNGLSQKIDVKFSSTT
ELLDVPVERNVNTLVFAPETAAINQPIRVFVQTTSDGLLVGNEPRELLGTTHVHLPSGIS
VTLTNSFKTLHQGLYYVDYTPIEEGTHVFHVVAFSQGTTSHGSAATNVLSQDLGGISDQI
VNLNSVLDETSSQLDVLKSEIKGFDTTLKYASSQIDENIGTFALSAKSISESSAQLNALL
LPIIASIGLIVALQIAILARRR
Download sequence
Identical sequences K0BGW6
WP_014965858.1.40567 WP_014965858.1.82955 gi|407465551|ref|YP_006776433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]