SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465603|ref|YP_006776485.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465603|ref|YP_006776485.1|
Domain Number 1 Region: 14-172
Classification Level Classification E-value
Superfamily TPR-like 1.55e-31
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407465603|ref|YP_006776485.1|
Sequence length 233
Comment hypothetical protein NSED_08755 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MVDLLDPSNVITRMFNAQKYDEMYEYCKNLLEKIPNDMVALQNISLSLIYLQKFDEAIIY
CDKVLKIKNSDTYALKNKIYALENLKQHEKVLELCQKILDVDPKDIWALNSMGLSLNELN
RHQNALEYYDTVLLIDPNDVTALMNKAISLSHLGKYKDAISYYDMAQVIDSNLKEIPLAK
SRLFEKLGMSDDAFLAAQGVLNKDMEKIKNSAKENKCSVFHQFCEEEFEKYNK
Download sequence
Identical sequences K0BBD8
gi|407465603|ref|YP_006776485.1| WP_014965910.1.40567 WP_014965910.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]