SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465621|ref|YP_006776503.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|407465621|ref|YP_006776503.1|
Domain Number - Region: 52-94
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0392
Family Zn-finger domain of Sec23/24 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407465621|ref|YP_006776503.1|
Sequence length 100
Comment ribonuclease P protein component 4 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MKLGAKKIAMERMEILIENAISNAKTNPELSQKQASIARRISTRHKIRMPYNLRMVFCKK
CKSFIAPGINSRIRLGRASVKSIRISCNLCGHTYRKIISQ
Download sequence
Identical sequences K0BH15
WP_014965928.1.40567 WP_014965928.1.82955 gi|407465621|ref|YP_006776503.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]