SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465824|ref|YP_006776706.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465824|ref|YP_006776706.1|
Domain Number 1 Region: 47-129
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000183
Family TSP type-3 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407465824|ref|YP_006776706.1|
Sequence length 137
Comment hypothetical protein NSED_09890 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MVGFAFIVFTLTGLLMTTSMSDSFAVKGKNNGSNGCENANPNSRVCEKNPNSSCDVTVST
EDCDGDGLTNSEDLCPFNPVGTLGQTDNDCDGDGLTNSFEDGTGCLDKTKVDTDGDSFSD
KLEIDTGSDPCASASTP
Download sequence
Identical sequences K0BE92
gi|407465824|ref|YP_006776706.1| WP_014966127.1.40567 WP_014966127.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]