SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407465223|ref|YP_006776105.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465223|ref|YP_006776105.1|
Domain Number 1 Region: 9-183,247-389
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.16e-50
Family tRNA pseudouridine synthase TruD 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407465223|ref|YP_006776105.1|
Sequence length 398
Comment tRNA pseudouridine synthase TruD [Candidatus Nitrosopumilus sp. AR2]
Sequence
MIPEIDCQIGISVYSTKFPGIGGRIRVKPEDFQVTELISEKIKNSINDQNGYAVYKLKKK
KIDTNHALSGIFRQKGIRLKSLGLKDASAITEQFVCSGNKGKSIESFSSDKYSLEKIGFV
KKPLSKKDMVGNHFKLKISDCKNDLESFVEFDKILNFYGYQRFGSKRPVTHLIGKAILQM
DFDRAVDLILSFTSSYDSKENNEIREKLSDRENYQQYFDQVPVQMDIERIVLKEMIEHGE
SVRAIRAIPISLRRFYIQAYQSFIFNQSLSAAFLDGENLFEAQSGDVCFDHNGIIGKYVK
GMDQNLALPFVGYSYYKKTRFDFQISKILKQEEISPKDFFIKEMQEASSEGGFRQAAIHC
TDYSSHGNVVEFSLSRGSFATILLREIMKPDDPILAGF
Download sequence
Identical sequences K0BA96
WP_014965533.1.40567 WP_014965533.1.82955 gi|407465223|ref|YP_006776105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]