SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|343127721|ref|YP_004777652.1| from Borrelia bissettii DN127

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343127721|ref|YP_004777652.1|
Domain Number 1 Region: 67-282
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.94e-56
Family DNA/RNA non-specific endonuclease 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|343127721|ref|YP_004777652.1|
Sequence length 292
Comment DNA/RNA non-specific endonuclease family protein [Borrelia bissettii DN127]
Sequence
MKKRSKFLLYCYILCLTGFLFFSLNPKALKQIKHKISDYLEIIENKYITITKSIPIKESQ
LIPKGYLTTQIISKKHYTLGYAESARQSEWAAYPLKREMVELALTLLKSKKIKRSTKFFE
DTNIRGTFPKLEDYFKSGYDRGHIVSSADMSFSENAMKDTYFLSNMSPQKSEFNSGIWLK
LEKLVREWAISKGYIYIISAGILTENKGFIGKNKILIPKNFYKIVLAINNNYYDIISFII
PNEKAKDLDLKNYVVSVDSIEKKTKIDFFEKLDSKIKKKIKKIQNTHSWKFK
Download sequence
Identical sequences G0ALL1
WP_014023645.1.90944 gi|343127721|ref|YP_004777652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]