SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|429190204|ref|YP_007175882.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429190204|ref|YP_007175882.1|
Domain Number 1 Region: 4-77
Classification Level Classification E-value
Superfamily PH domain-like 0.0000984
Family BPHL domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|429190204|ref|YP_007175882.1|
Sequence length 182
Comment hypothetical protein Natgr_0170 [Natronobacterium gregoryi SP2]
Sequence
MGTQQQYSRLESFIDSNETTIDGYQTQSEAGVLTNRQLISLKTTGRDNSKTTVNSVYLDQ
VSRAKIEHQKTPDVDQERLAYGIVSLFLAIISFALIGQFDSNIVEVTLVMVGVCVGLVGI
ALFIEAYDTPDDSVYIELQTPDGEPVWKRRLGGNQLEFAEKLSRTVSNAHDPSNQIAQKI
GT
Download sequence
Identical sequences A0A1I3QPH3 L0AC05
gi|429190204|ref|YP_007175882.1| WP_005579973.1.6326 WP_005579973.1.71579 WP_005579973.1.8181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]