SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429192048|ref|YP_007177726.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429192048|ref|YP_007177726.1|
Domain Number 1 Region: 16-77,110-243,272-313
Classification Level Classification E-value
Superfamily PP2C-like 1.57e-32
Family PP2C-like 0.0012
Further Details:      
 
Domain Number 2 Region: 396-452
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000689
Family FHA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|429192048|ref|YP_007177726.1|
Sequence length 531
Comment serine/threonine protein phosphatase [Natronobacterium gregoryi SP2]
Sequence
MEHASTVDIGERKRRSGGINEDSIATAVLENHHRSACRPLGIFVLGDGVGGETSGDVASF
LATTVVRKRLTETLLGSGTDLLERFDLDVYGGEPPTADENPASALSPRRIRAAIQDAVDD
AHQHVQEYARRIDGQPATTLVVAVSVDGRLHYGWVGDSRLYLVNERHERIQQLTTDHAVT
NDLLEQGEIEDEVGARVHESATAITNAVGGSPHGKPTVDVEFGSTDIYREDIVLLTSDGL
IDAYPDIAPLRAEYERVDDTEAVREEILEALVTDDEIRDIVLEADGLREGVADLIAFAND
RGGKDNLSVTLARDPTADPSPEDISKRSEAIESDGLIDQETVIETPGSDDGYESTDRNAS
AKSLESAADVVSATDTDLTTASIKIAGTETIYEIVDGVTIGRDNEEADGAGPNICLVVED
DAVERHHTRIERDDDGNWWLRNTSDAGTFVEDDGEWVHLQSGADDGTTSDSQFVRGGPEA
YRLQDGTTFTLEDPRETDPIAFKFFSSVGLARDRIDESESDDAGLLDRFRS
Download sequence
Identical sequences A0A1I3T5A2 L0AJC8
gi|429192048|ref|YP_007177726.1| WP_005577416.1.6326 WP_005577416.1.71579 WP_005577416.1.8181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]