SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429192204|ref|YP_007177882.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429192204|ref|YP_007177882.1|
Domain Number 1 Region: 98-231
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 1.86e-44
Family CTP-dependent riboflavin kinase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 11-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000506
Family MarR-like transcriptional regulators 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|429192204|ref|YP_007177882.1|
Sequence length 235
Comment transcriptional regulator of a riboflavin/FAD biosynthetic operon [Natronobacterium gregoryi SP2]
Sequence
MSVTSESAVGPDELAALKLLALEGGLEGDVKLSCSQLADRLEASNQTASRRLQRLEGASL
IERDTVSDGQWVTVTEDGERVLHAEYEDYRRVFETNSTVELEGTVTSGMGEGRHYISLPG
YKRQFADRLGYEPFPGTLNLDLREDSVRRRSAISSLEPVSIDGWEDDERTYGPAVCYPAT
IETSEGESYESAHTIAPDRTHHDEDQLEVIAPDKLREDLDLEDGDFVTVRVGDRR
Download sequence
Identical sequences A0A1I3KHT2 L9Y3H2
gi|429192204|ref|YP_007177882.1| WP_005579349.1.6326 WP_005579349.1.71579 WP_005579349.1.8181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]