SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427711240|ref|YP_007059864.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427711240|ref|YP_007059864.1|
Domain Number 1 Region: 1634-1894
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.62e-21
Family Integrin alpha N-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 2542-2702
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.96e-17
Family Integrin alpha N-terminal domain 0.0035
Further Details:      
 
Domain Number 3 Region: 1871-2070
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00000000000000471
Family Integrin alpha N-terminal domain 0.0019
Further Details:      
 
Domain Number 4 Region: 1271-1380
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000828
Family Clostridium neurotoxins, the second last domain 0.035
Further Details:      
 
Domain Number 5 Region: 3536-3612
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000575
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 6 Region: 3295-3455
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000157
Family Serralysin-like metalloprotease, C-terminal domain 0.0044
Further Details:      
 
Domain Number 7 Region: 2181-2363
Classification Level Classification E-value
Superfamily Sialidases 0.0000000000746
Family Sialidases (neuraminidases) 0.039
Further Details:      
 
Domain Number 8 Region: 2775-3020
Classification Level Classification E-value
Superfamily Sialidases 0.00000000706
Family Sialidases (neuraminidases) 0.026
Further Details:      
 
Weak hits

Sequence:  gi|427711240|ref|YP_007059864.1|
Domain Number - Region: 1070-1160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00504
Family Clostridium neurotoxins, the second last domain 0.09
Further Details:      
 
Domain Number - Region: 2087-2145,2317-2565
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0392
Family Integrin alpha N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427711240|ref|YP_007059864.1|
Sequence length 4096
Comment Calx-beta domain-containing protein,FG-GAP repeat protein [Synechococcus sp. PCC 6312]
Sequence
MNPYASYATTAVDLAGTNHILWENNGQLIHATYDQNSGTWDQARPVSDARGGENLKLLAG
NIYPYVEGGATNFAPGLIAFWEEGVANSKEIYAVVGRYGADGQIEWSRAVQLTNDGVADQ
NLDAALLQNGLMDVVYQKSLVMDPRNPAYSLNPAQMAIDAANPNRDDTDLYHTYLSVDLD
NNGNPYLNIFDGQVFDLTFAANEPTTAFYTPLGPGVQGISANDANSSPDPELATPQPSNN
PGLPQNSFMAGVTRGFNVVFGSPSKMVDGRIGVPLISSTSNFGLQLSGSVGLAGNRKALK
AKLGLQLSNYNKKDGTKAPDSGLGFSSSTRTGGNIFGYIYSINLGASGQINYNAETGNLV
GTQRAWEVDIGFYKQYKANFGSKEFSLGQFRAGIYFDVGIGAGFTFTDPLPGTTPPFLLV
VPEDANLYAGAAGTILAEIGFLMSSVPDANLGVGGGILQGVGDLAAVPILISAVDVTMPP
FVPWPGLDEYQNFAYGIEVPLGLKVQGTLGIFQNTLVASATATAGITFELATPNNNNPNF
AFSIPWQIGFQAGLQAGIFTWSWSWSKGGTIYNSDPSSSAALTLPSTEFAPDNNGLVTVG
YNPYTGNANHYQSLASKSVIQQLVGPNSNGGIQTTSTDQIGYATLSNGGANYFNGQSGSF
QIAIPGSSTNDPALATAFVTLGRITNLTITDQGSGYQDQPLAVQFNSSGGTGAGATVTVD
STGRITQVQVTNGGSGYLGGKSGNFVVTPSGSNTNPALLSVAVTNGAVTQVQILNPGLGY
SQSSVMIDFSQNGGGGTGGTALAQPINTQLVNVVNDGPPQISSITYNVNNTTQTATTLAW
VADGVDNVTPLTNSTQNNSLITRIQTASLSGTDWSAPESIPGVGSTGFNFDPAIGYYLDD
SGNPGRFLVWAHADTTLLNPSSPSYDIVGSLIETDIYYSIAASGEAWSTPQLLTQNLGSD
TKVTIGEGPTPGELIVSWVNTPLPNPQTGETSQTVYAAVFNGQTQAWTTPPTAIPNVGNS
TGKAIASLTIGEFQGNPAVFWSDTTTPGYAYTVLQNNPDFYFRLSEPVDSLVAFNWASGG
TSGNGTYVGTINYGQSGALLAPNGQGDPNPSVGFNGQGYVLAPGQVSKSTLGDFSVEFWV
NADNLSPGQSLVDQGVYNPTAVLPTAALPLTIIKAPTQRNGAWGYLYGVVIAANPSVNIT
NGGSGLSPFNLDLANLLPGTSLTLSDGTPVTLNGLPLLNLNVNNGELTGITGQAVTQIIG
STFVANPQAEGQQTTTFSQTETLTFNQTPGWYVRTGENNTIVFNAGGGEAVSSALNANTW
YYVAATYNSSTQTASLYINGELAAQQTGSRFSASGLPLILGYNFTGKLDEVAYYNSLITT
NTNSATLDSNGQVSSFDFSSNGQITAHYQNRFNDPNAAEDATFYSVYDPNSGVWSGATQF
SAQAADQPTYPLLERNPVVDIVANSTQLIPDGQPDSRVRVQIGPGVVAPGVTITGIKITS
VDGLNWTVGNAPEPGWAIGVVANGQLLNSLNPSADFAYTVMSLNPTLDLYFQDSYSESNL
VLGKTVDITFYIETSSGETQPTSPITATIIPNPISTIGGVTEDGREQVAIGVILENEVTA
LDQVNSGVVLDVPANTGKALAAGNFLNNQVALAISKPSANSSEGVVWVLPAGSTDTLDTN
NLQPLSETTPPPGGALIKDSTPSTNSNETQLGNVIAAGDVNGDGIDDLIIGAAEANNKAG
QVYVISGATITPNSTIDLANSAAVILSGQAGSQAGFAVAAGDVNGDGFADIIVGAPYASY
NGQQVGAAYVILGGQPFFNTPTINLNSNNLLLTGTSGSYIDQYLDNVTWTSQVGFSVAVS
RPKPTPPFYDLSPSQSVNGDNFADIVIGAPNYRQAVQFAGDGLNQGATKAQGQAYSQLVA
TVANTGSGYSYTKNMNTGRGYIIFGGQTLPTNLNDSSFNGSNGVVLDGSPMTVSDTQLGW
AVSTGNDVNGDGFDDVLIGAPYGNNGTGLSFVLAGQASGSLFQSEYVLTQAADLVIGGNS
AFSFMGKTLSLAGDINGDGLADLVLGAPNTQYSTGQAHVIFGKDRIFSNGTPNYISLQPG
ATSGVFNLNGGGVGHLAAGSMWSGTDVNGDGIDDLLLSAPYGGSAYAVLGHPWLADDGSL
KLSNLAGDNGLVIDGTDLSNSFAAQNLNGLSNNSPSMTNDGDDTLFIAVRGTNNVDYVAA
STNGGQSWGGFNALPPGETDDYFPSIAFYDGVLYLAYAGGGYNQVFIAYSTDQGQTWESD
NYYALGNTASGTAPTLVVYQGQLMLLTINENNGDIQYVYSSNPEDPNAWSNTYNVTYNNG
SANQTSSSAVGAAVLDDTLYLVYQEGTLGSPSTGVYGLGTATLDVNNPTDLGNLIWDYNG
NTNIGLGATQGVGLTADSKQLYLTYTDGQGAFYVNTSPNGLDWRNAIVIPNQFSNLAPAV
TTLNDQLYVGYTGTDTSIYVTNTAFPVLGNVSGSPARLLGDINGDGFADVLAGGENASLV
IFGKGTEALLDESLGTSDLTLTLANGGFQDVFGLGDVNGDGLKDLGGIDNNNNAYLLLGN
ADLGTKTQLTVNPLPNTTPTPLNFGTPAGDLNGDGFADVIVGFQPTTPDSTNYNQLYIGF
GNVTGTLNFQALNLPQNTSVKSAGDINGDGFEDLVLGNPALNQSAGGVYLLLGNPNLATQ
VSTNTPLPVTTYPSTPIVNTPAANDLNWSGESTNNINANFNDPIRGTLGNTGLSTVVFNG
EVVTIWVNQNNQLAFSTTKDPQNWNSGNLFPNNFQTDAVPGLVEFNNQLYAYWYYSGNGA
NSTAIYYSQYQGNGQWGQLGYTNLTNNDLNPSNGLGGGIDLVEYNNTLFAIWQGVGNDQG
NSLFFSQSTDGINWTTPQGIPDAAIWQQESVPSLVVFQNTLYAYYVGEGGQGVFYTTFDS
ATNAWTPVQFISNLSSENNALTNYGLSLVNIDDKVLYASWVGGQNANNDLFLASSTDGVN
WTVPNQVDNIYGWGIPSLYLFDNELNLVSPAATNNNTSDTSIVTTASQQIVYPTALGNNL
APVGDVNGDGFGDVVIYAPLFPNQTGTPGAAYLWFGAATGFSSSQVLLTGANLTADITFS
TAGDVNGDGFDDILIGNPNYSNSTNGQNAGISYVVFGASNLTNLSSINLDELQPVSTSGG
TITDGKIGAISLTAAGSGYLSNGSGTFSIVVASPSSTEAAIIQATVTGGAITGVQVTNPG
AGFTSINTLSFDYSQGGDGTGASITVNSLVSLAGFQIVGDANSNAGQSVSGGGDVNGDGF
DDIAIGAPGDSLSYVLFGGDFTASVNQYGSIGDDTLEGTATGDVLMGQAGNDVLLGKGGL
DVLLGATGNDWLQVQDPNFRRVNGGSGTDTLALYGYNAQAWDLTALAPGSRIKNIETIDI
RNYGSNLFTLNQATILQLSPTKILTINGDNSDTINLSPDLTANGTQYANGQTYAVYQAGV
AQAWINTMIPSGNISFTASSTNSPGPVPPTTLTGVSNNPHLVAPTLTSTGSTNQATQFAV
NSPVIAENGQALIFTITRSGNLAQSAAARYRTLNNSAQAGVHYDAQAGYVVFAPHEAVKE
VVIALKDDQEFGPRQRQVHLGLVPLTSTAAALLSNRSLSFTNAPGTQLRNLGMNPVGLEQ
GLSRMGGLPFAELNFNVSTPNGKTTVTSAVNGLSSLNSYFRFNPRVKKYEEFLYDGHTGV
EFLDTTGDNLVDTLKIHLVDGGRGDSDGVVNGVVAGFNAPGQVTPGPIQVNPGIFYIPTA
SDGALQFHNVTAQGAYRFGLFQVDDAQGRIGHLLPSNPGYGAAAQARQQTIFQNASASNL
NALTANTAHAALEDPQLLVQSEFQANGAFQATALTGNQHYGMFLSQNGQTQLSTSDPAFE
AEADSRGYFDLRWSNTQFEVGTPVLVTPGQPGQTITAQVEIARGGAYNNTLALFKVDSLT
GGLDTTGDGIIDLQPGDTTYTQAVMERIQDPLTGKLLPTVPTIFTSQGQSVTLPTGFLYG
MALITNGSLGEFLGSNPSNASTGFIHTFFSFEAANPDGVAHIRRLGQTLWGFEDLFGGGD
LDYNDMVVGLTWQHHS
Download sequence
Identical sequences K9RP66
gi|427711240|ref|YP_007059864.1| WP_015122865.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]