SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427711415|ref|YP_007060039.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427711415|ref|YP_007060039.1|
Domain Number 1 Region: 14-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-59
Family Protein kinases, catalytic subunit 0.0000994
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427711415|ref|YP_007060039.1|
Sequence length 487
Comment serine/threonine protein kinase [Synechococcus sp. PCC 6312]
Sequence
MTVTPLALGNSLQGGKYRLDALLSQGGFGVTYRATHTLLHQTMVLKTINPAQHDPQQLAQ
IGQRFIHEAQRLAKFQHPHIVRVSDCFIEGGLPFIVMDYIPGQTLAALVRNRPLSPDQAI
HYIKQVGSALALVHDHGLLHRDVKPDNIMLRQGTDSVVLIDFGIAREYTPGKVETNTGML
SAGYAPVEQYLPKHQWSPATDIYALAATLYALLAAKPPVASVLRDRVPLDSLQKFQRNLS
PGLEAAVLAGMALDARDRPQSVAEWLDLLDETESGNGRAGVSAMTTSTVAVLPQTRPIIP
ATQPELASARKFRSQPSPSRSMWHSPWFWLLGTAIVGSGLGAGLGLWLRQQTSTPGAPPL
IQQNESFPPTRPPVTPQPLPLELPPTAAESPNLPLPSPETSPTPPIDGPPAVETPTPTPT
ADPNGAISPPIEKTPPPSGNETPAPEPPPIVPPDPVPVEPPKPPPGAEPKPEATAPPVNE
PKPSGNP
Download sequence
Identical sequences K9RPN7
WP_015123040.1.5248 gi|427711415|ref|YP_007060039.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]