SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427711836|ref|YP_007060460.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427711836|ref|YP_007060460.1|
Domain Number 1 Region: 5-138
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 7.51e-50
Family XisH-like 0.000078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427711836|ref|YP_007060460.1|
Sequence length 138
Comment XisH protein [Synechococcus sp. PCC 6312]
Sequence
MPKLDIIHNAVKNALIKDDWVITDDPYVIQYRRTVLYADLGAERPIGVERDGQKLVVEVK
SFIGASKIQDLKEALGQYDIYRYLLEETAPDRKLYIAISNVAYNTFFTQDVTQLILNKHQ
LPIIVVDIEIEEIMQWIN
Download sequence
Identical sequences K9RS60
WP_015123461.1.5248 gi|427711836|ref|YP_007060460.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]