SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427711858|ref|YP_007060482.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427711858|ref|YP_007060482.1|
Domain Number 1 Region: 17-77
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000233
Family Alr1493-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427711858|ref|YP_007060482.1|
Sequence length 110
Comment hypothetical protein Syn6312_0721 [Synechococcus sp. PCC 6312]
Sequence
MALAIALEPAPIETDAYGVVRVSRTRVTLDTVVTAFLEGCTPEEIGEQYPSLQLPDIYLV
IGYYLRHRDEVHTYLSERQRQANIIQQEAEQRFNPIGIRDRLLARRNQSR
Download sequence
Identical sequences K9RRQ2
WP_015123483.1.5248 gi|427711858|ref|YP_007060482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]