SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427711888|ref|YP_007060512.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427711888|ref|YP_007060512.1|
Domain Number 1 Region: 47-445
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.6e-103
Family GABA-aminotransferase-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427711888|ref|YP_007060512.1|
Sequence length 448
Comment hypothetical protein Syn6312_0751 [Synechococcus sp. PCC 6312]
Sequence
MTQTPIKPSGIPDQEESLREKVFDTVKEFYQYKFAKREFHPGQTYVPVSGKVFDEHELVN
LVDSSLDFWLTTGRYAAEFEARFAEWMGVKHCLLVNSGSSANLVALSTLTSERLGDKRLR
PGDEVITVAAGFPTTVNPIFQNQLKAVFLDIQLGTYDIDVSQLEAAYSSQTKAIMVAHTL
GNPFNLDAVMAFAEKYDLWVIEDNCDAVGSEYNGQKTGSFGHLATVSFYPAHHMTMGEGG
AVLTNDTRLKKIAESFRDWGRDCWCPPGVDNTCNKRYGWQLGTLPFGYDHKYTYSHVGYN
LKMTDMQAAVGVAQLEKLPQFIAQRQANYQFLYEKLQDLTNYLILPEPAPNSTPSWFGFL
LYVREDALFSRNELVQYLEEQRIGTRLLFGGNLVRQPAYKSLDYRTVGNLKHTDDVMERS
FWIGLYPGLTTEMLDYVVSVIKDFCWRY
Download sequence
Identical sequences K9RRS8
gi|427711888|ref|YP_007060512.1| WP_015123513.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]