SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427711950|ref|YP_007060574.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427711950|ref|YP_007060574.1|
Domain Number 1 Region: 48-236
Classification Level Classification E-value
Superfamily GAF domain-like 2.03e-28
Family GAF domain 0.00027
Further Details:      
 
Domain Number 2 Region: 232-360
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000259
Family HD domain 0.024
Further Details:      
 
Domain Number 3 Region: 441-538
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000055
Family HD domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427711950|ref|YP_007060574.1|
Sequence length 564
Comment HD-GYP domain-containing protein [Synechococcus sp. PCC 6312]
Sequence
MRGYTWNVQQICVQGAAIKLRPMNPSPKTTLPPVDVLSHDPRGLVTELLAVGTALSATEN
LSDLLTLILTKSREITCSDAGSVFLVDRQAHPPNLWFKTAQNDTHPELSLHEFFIPLNAE
SLVGYVALTGEILNIPDAYEIPQAETYQFNRSFDDNLGYRTRSVLVIPMQNAEGEIIGVL
QLLNRKIRADIKITPDNATDVTVPYSHWEEAILRSLASQAAVSIERNHLLESIEKLFEGF
VTASVQAIEARDKITAGHSERVADLTLRLAAEVNDQAGIGAFVGVGFDQRQLQELRYAAL
LHDFGKVGVPEVILSKEKKLYPLQLEIIRQRFHFVRRTLELECNQAKLDYLQANPHHDPD
AGTCDHCQQLRQFDLQLQAQLQNLDRYWQVVEIANEPKVLAEEPLGILQELTSWHYKDIN
GHLQPLVTIAELEQLLVRRGNLTPQERLAIESHVTHTYEFLRRIPWTSSLKDVPIIAYGH
HERLNGTGYPLGIADIPLQTQMLTIADIYDALTAADRPYKKSLPVPIALKILHQEAESNQ
INRDLVLLFEQKQVFQVLGHGLAD
Download sequence
Identical sequences K9RR69
gi|427711950|ref|YP_007060574.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]