SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427712353|ref|YP_007060977.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712353|ref|YP_007060977.1|
Domain Number 1 Region: 72-155,185-320
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.28e-17
Family Pectin methylesterase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427712353|ref|YP_007060977.1|
Sequence length 380
Comment hypothetical protein Syn6312_1252 [Synechococcus sp. PCC 6312]
Sequence
MVVKQVRNAIFAGLSGAVVIMAFANNLHDVAQRWWPNPFQDSLSPDTNPHLNAIAQAADT
PPNPNLLDRLQALTSTPTFYVAADGTDQSDGTANAPFPTLSQAITAVTAAQAKEPQAQFI
IQLAAGTYGDANTSEPLLIPPGVTLKGQGTATTVKQSLQLSHNSRVEQLVLNETGILIRP
QENATGEVSVEQVSITRGFLTIKAAGPLPTPKIQVKHVTMADSCILVSGVAKPEIRDVQM
RGNVGVDDFSLAHCSENGLLASGDTMPLIQLLGAATLENILVSNTNLAIFNQSEGSVIKN
LRIVNSLNGIENRGNLSLDGPNLENVSYTGICNHGSLTLQRPGFDPTTAITTPQCLVPGL
DQPPPSPINLAGNLDTIKVN
Download sequence
Identical sequences K9RT25
WP_015123978.1.5248 gi|427712353|ref|YP_007060977.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]