SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427712464|ref|YP_007061088.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712464|ref|YP_007061088.1|
Domain Number 1 Region: 343-538
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.42e-52
Family Ppx associated domain 0.003
Further Details:      
 
Domain Number 2 Region: 147-329
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.3e-43
Family Ppx/GppA phosphatase 0.00061
Further Details:      
 
Domain Number 3 Region: 20-143
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.12e-34
Family Ppx/GppA phosphatase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427712464|ref|YP_007061088.1|
Sequence length 556
Comment exopolyphosphatase [Synechococcus sp. PCC 6312]
Sequence
MSGVPVLQLWRSHNPEQRILAAIDVGTNSIHMVVVDINPTLPSFKIIAAQKDTVRLGERC
EQTGQLTLAAMERALGSLRRCRELADSLRAEAVIGVATSAVREAPNGLEFLQQVRDETGL
EIALISGVEEARRIYLGVLSGLEFQGQPHVIVDIGGGSTELILGDGHEPRYLSSTKVGAV
RLTDMFVQSDPISERDFEQLRGYVRGMLDRATEELRSHLRPGEVPKLVGTSGTIESLMNL
HVWQTLGHAPASLQGYTLTQTDLKGLIQKLRPLNYHQRTQVPGMSEKRAEIILAGAVVLS
EVMNLLEANSLQICDRALREGIVVDWMLSHGLIEDRLRYQGSVRQRSTLGMAQKFRVNLP
YSERVAAFALSLFDQTQGILHQWGELERELLWAAAILHNCGHFVSHSAHHKHSYYLIRNG
GLLGYTDTEIELIANLARYHRKNTPKKKHENYRNLTSREHRVVVEQLSAILRLAIALDRR
QVGAIQDISCRWQSESQEFTLILHPSNANDACELELWSLNYKKEAFEMVFNLKLEAHLES
SDPGAKTPIEETVTLA
Download sequence
Identical sequences K9RRG8
gi|427712464|ref|YP_007061088.1| WP_015124089.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]