SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427712524|ref|YP_007061148.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712524|ref|YP_007061148.1|
Domain Number 1 Region: 175-490
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.51e-113
Family Leucine aminopeptidase, C-terminal domain 0.000000328
Further Details:      
 
Domain Number 2 Region: 1-178
Classification Level Classification E-value
Superfamily Macro domain-like 5.53e-27
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427712524|ref|YP_007061148.1|
Sequence length 492
Comment leucyl aminopeptidase [Synechococcus sp. PCC 6312]
Sequence
MNIQAPTTAVLNWSGDLIAFGFFTESDAVVWPAELAELPQAWDGILPELIHDAKFQGKAG
TSLTVRLSPKSPVKKIMLVGLGAASDFTLETLRRAAATVVKSARKDHDKTVGLYVPIYDN
DPTQALAEGIHLGLHQDLRFKSDPEAKENLAFPESIDLLGPGVVQEALPIAAIRAEGVIL
ARELVNAPANVITPVTLAEKAQAIASTYGLESEILEQADCEALGMGAYLGVAQASDLPPK
FIHLTYRPQGTATRKLAIIGKGLTFDSGGLNLKVSGSGIETMKMDMAGSAAVLGAAQVIA
QLKPSAEVHFIVAATENMISGKAMHPGDILTAANGKTIEINNTDAEGRLTLADALIFAEK
LGVDAIVDLATLTGACIVALGESIAGLWATDQPLADHLLTAANQAGEKFWQMPMEEKYFE
GMKSPIADMKNTGPRAGGSITAALFLKQFIQSTPWAHLDIAGPVWVEKEDGYLNPGGTGF
GVQTLVNWVLAS
Download sequence
Identical sequences K9RRM8
gi|427712524|ref|YP_007061148.1| WP_015124149.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]