SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427712556|ref|YP_007061180.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712556|ref|YP_007061180.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.5e-37
Family Ribosomal protein S14 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427712556|ref|YP_007061180.1|
Sequence length 100
Comment 30S ribosomal protein S14 [Synechococcus sp. PCC 6312]
Sequence
MAKKSMIEREKKRQRLVEKYAAKRAELKEQIAYAENPDEQLTLHRQLQQLPRNGAQTRLR
NRCWLTGRPRGYFRDFGLCRNALRDMAHQGLLPGLVKSSW
Download sequence
Identical sequences K9RU44
WP_015124181.1.5248 gi|427712556|ref|YP_007061180.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]