SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427712683|ref|YP_007061307.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712683|ref|YP_007061307.1|
Domain Number 1 Region: 128-397
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-55
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 13-96
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000000402
Family FHA domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427712683|ref|YP_007061307.1|
Sequence length 404
Comment protein kinase domain with FHA domain [Synechococcus sp. PCC 6312]
Sequence
MVTLSLLDPWKRTPVKRWRFPAKPTIRIGRAADNDIILNDILIARYHAEVACYTDPENLG
RWYVKNVGPTGTFLDGKLVSDGPLGNGSLLQLGPTGPILQFEVLSRRNAPSTLATCQHIG
NMPGNLFCIHCGQPLNVQRTIRNYQVLRLLGHGGMGTTYLVCQETDYRPNQLPQVWVLKE
LRSDVEAEDKVQELFEREARILQGLCHAGIPKFHDYFIEDGKKYLVMELIHGLDLDRWVI
RNGPVEPAQAIQWMLQTCGVLDYLHNQDPQVIHRDLKPSNLLVRSSDNQVVLIDFGAVKE
VGHSPGTRIAVEGYSAPEQMLGHPVVQSDLYAVGATLAFLLLGDSPIRFYRHEMGVYRLN
ILDQPSVPENLKLVIQRATEPQVSNRYQSAIELARALKGCQENA
Download sequence
Identical sequences K9RTY5
gi|427712683|ref|YP_007061307.1| WP_015124308.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]