SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427712701|ref|YP_007061325.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712701|ref|YP_007061325.1|
Domain Number 1 Region: 45-338
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-35
Family TK-like PP module 0.0099
Further Details:      
 
Domain Number 2 Region: 373-577
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.48e-30
Family TK-like Pyr module 0.092
Further Details:      
 
Domain Number 3 Region: 583-733
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000255
Family Transketolase C-terminal domain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427712701|ref|YP_007061325.1|
Sequence length 734
Comment phosphoketolase [Synechococcus sp. PCC 6312]
Sequence
MAAVLSSPTPPDFCQGVQYFGQDWPDWETHGTTPIISADSQYILDPQDPTAAYQTLLYAE
ALRYLMLQMTASKASGHPGGFASQAEAYAALVMLGHKNIITEVGHHAPGFYSAMFLDRSL
EAMGINTVEDLRGRFREKHGLLGHLSGYIPGILAPAGPLGQGQHFAMSAAWLHRDTLFPF
TVGDGGLGEPYVMSSIAHFNTAFPTVTNFLPVLVWNGFSQEHHSMVSLKSNQEMIAYWQG
NGFKNVVLVDAKDFDDQAQAGAYVDSTIFSFKQRLAFSQAVLQGVDQAAKSALSGELTVF
IIKQLKGAGVHAKGAKSHNLYGHHTLENPDIIAALEKRALSPGAWELVRTNCERAGGGPA
AKVAVTESILDLPDLGKLPLEAYGLGEAKVATTAMGRLVADVGQKDRRYLVTNADGNEAS
GIANINQALKIIHPTTDDLYNQAPDGQVYEPLSEDACAGLAAGLALMGSRSLWCSYESFA
INGLPIWQTVTQAMAELRRPTPSTITLYTAGALEQGRNGWTHQRPEIEAYYAAMMRNGNV
FPLFPPDANSVQVCYRWALGTFNKGISIIASKTPLPIRTTFEQTEYALDHGAVTLQDSGS
GKTIVLAALGDLILIPVLEAAQQLESQGYRVRVVSVINPRRLYRPSDVAWETCSEPDGGF
ASDAVFNELFGGDALIGITGGPGAMLEPLLLRSKLNRDILAWQRGETTASAGELLGFNGL
TAEKISSRAVSLLG
Download sequence
Identical sequences K9RUJ6
WP_015124326.1.5248 gi|427712701|ref|YP_007061325.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]