SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427713013|ref|YP_007061637.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427713013|ref|YP_007061637.1|
Domain Number - Region: 26-56
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000935
Family Transcriptional factor domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427713013|ref|YP_007061637.1|
Sequence length 75
Comment hypothetical protein Syn6312_1961 [Synechococcus sp. PCC 6312]
Sequence
MDSSILNQIMARLSHADQIRLLVSHPFFTGRCPQCHSRVPLSQANLGQAQCTHCGWQDLD
LQQEELREDSITPSC
Download sequence
Identical sequences K9RUX0
gi|427713013|ref|YP_007061637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]