SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427713194|ref|YP_007061818.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713194|ref|YP_007061818.1|
Domain Number 1 Region: 206-456
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.23e-26
Family Protein kinases, catalytic subunit 0.0013
Further Details:      
 
Domain Number 2 Region: 2-98
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.78e-20
Family FHA domain 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|427713194|ref|YP_007061818.1|
Domain Number - Region: 181-200
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.0183
Family NOB1 zinc finger-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427713194|ref|YP_007061818.1|
Sequence length 464
Comment protein kinase domain with FHA domain [Synechococcus sp. PCC 6312]
Sequence
MITLTLLHPVQATPVQSWTFEHESVVRIGRAVDNHVVLYSAVVSRHHVELRRSGLHWEVV
NLGTNGTYLDGKRVQQASLNDGGILRLARSGPNIQIRIGASSQPPPPNARMDTMPERGTI
PEQYVDPAKMTIGGVQTEAETRPQGIGQSQTGEEDDEESDRKFHVAGDLPLEFLGEYQGS
ECQHPHKTDTDLFCPDCGSPLQVQKTLGPYKVVWELAEEGRFLAWRAGRTVVLQALSSQA
NMANRSTFRHQARQLCQLDHPSLPKFYEAFAVDGQSYLSAEMVYGQNLEVKVKEEGALEL
AEVCQRLRPICELLDRNHREHPPLIHQHIQPSNFISALLPRPGSAPDSVAGEWVLVGWGH
VAVTTAETGTMMSNMGYLPPEQQAGQVQPASDLYGLGATLVYLLTGYEPDAYFRWGVKEY
RLYAEDIPRLNPAIADVINTLTDPNPAARFSSATQAIEQLITLI
Download sequence
Identical sequences K9RTK0
WP_015124818.1.5248 gi|427713194|ref|YP_007061818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]