SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427713338|ref|YP_007061962.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713338|ref|YP_007061962.1|
Domain Number 1 Region: 210-284,317-435
Classification Level Classification E-value
Superfamily PheT/TilS domain 7.32e-65
Family B3/B4 domain of PheRS, PheT 0.00000403
Further Details:      
 
Domain Number 2 Region: 36-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.86e-44
Family Myf domain 0.0021
Further Details:      
 
Domain Number 3 Region: 527-743
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.39e-42
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000859
Further Details:      
 
Domain Number 4 Region: 755-857
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.05e-24
Family Anticodon-binding domain of PheRS 0.0008
Further Details:      
 
Domain Number 5 Region: 445-534
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000192
Family Domains B1 and B5 of PheRS-beta, PheT 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427713338|ref|YP_007061962.1|
Sequence length 858
Comment phenylalanyl-tRNA synthetase subunit beta [Synechococcus sp. PCC 6312]
Sequence
MRISLKWLREFVPFTDSPTDLASRLTLAGFEVEDIEDRTTWAEGVVVGKILTCEPHPNAN
KLRVCQVDIGEDDPYTIVCGAPNAAAGMLAPVAPPGTYLPQIDLKIRPTKLRGVLSSGMI
CSLAELGLAKESAGIHSFENTENSLKAGQDVRPLLGLDDVILDVTSTANRADALSMIGIA
REVAALTQLPLRLPDVGEIKIPKSGQKLPYPLNVNLDIADPQACPAYIGTVIAGVKIGPS
PAWFQERLVAAGMRPINNVVDITNYILLTWGQPLHAFDADRLQTLATTAQAPDLPAKTSK
KASVSLDQAFSERPELTIGVRLAQAGETLKTLDGQDRTLTPNNLVITAEDYPIALAGIMG
GAETEVHDGTVNLLLEAALFSPVAIRKSARAQGLRTEASTRYERGVNPAELFQACDHALD
LIQTLTGGQIQSQVIFDQRPPLTRTLELRLSRLQQVLGPVDAPEEDIEDLAAEVVESTLK
SLGFGLEPIAATASKDEERSPAWTVTVPPYRFRDIEREIDLIEEVARLYGYDRFIDTLPS
KSELGYLPLEQSLTRAIRAACRGAGLTELVHYSWIRPGSDTTGKITVVNPLVAEFSALRT
DIITNLLNALQFNLEQGNPPLNGFEIGRVFTQDDEGLWETDHLGGIISGDPLRGKWVRGA
KASQPLSWYEAKGILTSIFDRLGLGVEYQPDRRDDRLHPGRTASLWLQGERLGTFGQLHP
QLRQARDLPEAVYVFELDMEVLLDHLMQHQARQLFCPYSTYPATDRDLALYAPIEVSVSE
LERIMIKAATFGKQETLLESVELFDQYVGEGVPSGQRSLAFRLIYRASDRTLTEADVTPI
HQAIRDALQDKFAVTLRS
Download sequence
Identical sequences K9RVW1
gi|427713338|ref|YP_007061962.1| WP_015124962.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]