SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427713491|ref|YP_007062115.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713491|ref|YP_007062115.1|
Domain Number 1 Region: 1-68
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000000154
Family 7-Fe ferredoxin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427713491|ref|YP_007062115.1|
Sequence length 75
Comment hypothetical protein Syn6312_2471 [Synechococcus sp. PCC 6312]
Sequence
MAHTIVTETCAGIADCVEACPVACIHPGPGKNTMGTDWYWIDFATCIDCGICFQVCPVEG
AIVPEERPELQKTPA
Download sequence
Identical sequences K9RWY0
WP_015125115.1.5248 gi|427713491|ref|YP_007062115.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]